KEGG   Lactobacillus johnsonii FI9785: FI9785_797Help
Entry
FI9785_797        CDS       T01120                                 

Gene name
dfrA
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ljf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ljf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724795..725298
Genome map
AA seq 167 aa AA seqDB search
MIRFIWAEDEDGCIGYRGALPWHLPADLKHFKELTSNHIIVMGRKTFDSFPGLLPKRKHI
ILSTNPILQRRYQDNSRVKVFSQIKQLKNWIEDHTEETIDIIGGAEVFKEFKDDVDVLEK
TKIHHIFKCDTWMPELKYEDFKLVNSESHRPDENNKFDYDFLEYKRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgattagatttatttgggcagaagatgaagatggatgtattggttaccggggtgctttg
ccctggcatttgcccgctgatttaaaacattttaaagagctgactagtaatcatattatc
gttatgggacgaaaaacatttgatagttttcctggattacttcctaaaagaaaacatatc
atcctttctactaatccaattttacaacgtagatatcaagataattcacgagttaaagtt
ttttcacaaattaaacagttgaaaaattggatagaagatcacactgaagaaacaattgat
attattgggggtgctgaagtttttaaagaatttaaggatgatgtagatgttcttgaaaag
acaaaaattcaccatatatttaaatgtgatacatggatgccggaattaaagtatgaagac
tttaaattagtaaattctgaaagtcatcggccagatgaaaataataaatttgattacgac
tttttagaatataaaagaatataa

DBGET integrated database retrieval system