KEGG   Lactobacillus johnsonii DPC 6026: LJP_0141Help
Entry
LJP_0141          CDS       T01960                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ljh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161612..163561
Genome map
AA seq 649 aa AA seqDB search
MCGICAFFDPELKDKDCAIQGMMDTIKHRGPSSDGKYTNDQVALGFRRLSIIDLRGGSQP
IFNEDKSRAIIFNGEIYNFKPLRKELIDAGHTFTTKADTEVLLHGYEEWGMDGLLKKVRG
MFAFVIWDDNTKTLYGARDFFGIKPMYYSDQNGKLIVGSELKSFLAYPGFKKELNTEAVK
PYLMNQYNDLKETFFKGVYRFPAGHWFEYKDGKMKTHQYWDAKYVENSLSFEETLDKINE
DLKETVDLYRNADVPVGAFLSEGIDSSYLTSLLDPEDVFSVSFDDSTYNEASKAKALSDL
HGWKFFADKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNDVIKVFTAGLKKLPKKSRVRLAHKIKKMPNFPGKVHMYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANGILRDKYKNDLTVNGIYQEDFKKVKNIDEVKQMQYID
LHHFMLNDIEQKADKISMAHSLELRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPEEWAQRPKLGFPTPIKQWLKEPRFYKQVRELFTEDFVDDIFDQKKIVKLLDDNYKG
DGSARRQIWAIYTFLVWYKLFFVDYDETVKKYQHVQPEVAELIESGRLV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgtgcgttttttgatcctgaattaaaggataaagactgtgctattcaa
ggaatgatggatacaattaaacaccgtggtccatcttccgatggaaaatatactaatgat
caggtggctttaggttttagacgtttgtcaattattgaccttcgtggtggaagtcaacca
atttttaatgaagataaaagtagagcaattatttttaatggggaaatttataattttaaa
ccattaagaaaagaattaattgatgcaggtcatacctttactactaaggctgatactgaa
gttttgcttcacggctatgaagaatggggaatggatggcttattgaagaaagttcgtggt
atgtttgcttttgtaatttgggatgacaataccaagactttatatggtgctcgtgacttc
ttcggaattaagccaatgtactactcagaccaaaatggtaagttaattgttggtagtgaa
ttgaagagcttcttagcttacccaggctttaaaaaggaattaaatactgaagcagttaag
ccatacttaatgaaccaatataatgacttaaaggaaactttctttaaaggtgtttaccgc
ttcccagcaggtcactggttcgaatataaagatggcaaaatgaagactcatcaatactgg
gatgctaagtatgttgaaaatagcttaagttttgaagaaaccttagacaaaatcaatgaa
gacttaaaagaaactgttgatttatacagaaatgcggacgtaccagttggtgcattcttg
tctgaaggtattgattcttcttacttaactagtttacttgatcctgaagatgtcttctca
gtttcttttgatgattctacatataatgaagcatcaaaagctaaggcactttctgactta
cacggctggaaattctttgcagataaagttgatgcagatgaagcaatgcgcgacttccca
gaaatgcaatatcacatggacgaaccagatgctaacccatctattattccattatggtac
ttgtgtaaattagctagaaagcatgttactgttgcactttctggtgaaggtgctgatgaa
ttatttgcaggctacgttaactatggaatgcatacccataatgatgtaattaaggtcttt
actgctggccttaagaaattacctaagaagagtcgtgttcgtttagctcataagattaag
aagatgcctaacttcccaggtaaagtccatatgtacactaacttggcagagccaagtgaa
ttttatgttggacaatctgtcatttatgatatggactatccaactatctttacttctaaa
gatgctaatggtattttgcgtgataaatataagaatgatctgacagttaacggtatttat
caagaagactttaagaaagttaaaaatattgatgaagttaagcaaatgcaatatattgat
cttcaccactttatgcttaatgatattgagcaaaaagcagataagatctcaatggctcac
tctctagaattacgtgtgccatatcttgataagaagattgcagaacttgctaactcaatc
ccaactaagtatttagttaaccgtcacgatactaaatatgctcttcgtaaagcatctgag
aaggtcttaccagaagaatgggctcaaagacctaagcttggctttccaactccaattaag
caatggcttaaggaaccaagattttacaaacaagttagagaattatttactgaagacttt
gtagatgatatttttgaccaaaagaagattgttaaattgcttgatgataactacaagggc
gacggttcagctcgtcgtcaaatttgggctatttacactttcctagtttggtacaagtta
ttctttgttgattatgatgaaactgttaagaagtatcaacatgttcaaccagaagtagca
gaattaatcgaaagtggcagacttgtttaa

DBGET integrated database retrieval system