KEGG   Lactobacillus johnsonii DPC 6026: LJP_0169Help
Entry
LJP_0169          CDS       T01960                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJP_0169
   01230 Biosynthesis of amino acids
    LJP_0169
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_0169
  Energy metabolism
   00680 Methane metabolism
    LJP_0169
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJP_0169
Enzymes [BR:ljh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJP_0169
Exosome [BR:ljh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJP_0169
  Exosomal proteins of melanoma cells
   LJP_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202698..203390
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattccagaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggct
actgctgaaaaatacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggcagaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system