KEGG   Lactobacillus johnsonii DPC 6026: LJP_0169Help
Entry
LJP_0169          CDS       T01960                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00010  Glycolysis / Gluconeogenesis
ljh00260  Glycine, serine and threonine metabolism
ljh00680  Methane metabolism
ljh01100  Metabolic pathways
ljh01110  Biosynthesis of secondary metabolites
ljh01120  Microbial metabolism in diverse environments
ljh01130  Biosynthesis of antibiotics
ljh01200  Carbon metabolism
ljh01230  Biosynthesis of amino acids
Module
ljh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_0169
  Energy metabolism
   00680 Methane metabolism
    LJP_0169
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJP_0169
Enzymes [BR:ljh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJP_0169
Membrane trafficking [BR:ljh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LJP_0169
Exosome [BR:ljh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJP_0169
  Exosomal proteins of melanoma cells
   LJP_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AEB92508
UniProt: F4ADQ2
Position
202698..203390
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattccagaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggct
actgctgaaaaatacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggcagaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system