KEGG   Lactobacillus johnsonii DPC 6026: LJP_0188cHelp
Entry
LJP_0188c         CDS       T01960                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_0188c
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJP_0188c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(222722..224170)
Genome map
AA seq 482 aa AA seqDB search
MTGYTMPKGFLWGGAVAAHQLEGAWDEDGKGMSVADVMTVGSATKPREITDGVIPGKNYP
NHEAIDFYHHYKGDIKLMAEMGFKAFRTSIAWTRIFPKGDEEEPNEAGLKFYDDLFDECH
KYGIEPVITLSHFEIPYHLVKEYGGFTNRKLIDYFVRFARVCFKRYKNKVKYWMTFNEID
NQSSFNNDFLMATNSGILFKNGMGDKEKEAAMYQAAHYELVASALAVKEGHKINPDFQIG
CMINYSPVRPLTPSSDDVLLADKFEQRRDFFSDVHVNGEYPNAVEDYIERNGYRPDITEE
DKIALKEGTVDYVGFSYYQSTTVSNKKVKPDELTDLQEAIVENPTLERSDWGWEIDPEGL
RISLNHLTDRYHKPLFIVENGLGAYDKREADGSVHDPYRIDYLRKHIEQMEKAVVLDGVD
LMGYLPWGCIDLVSAGTGQMDKRYGFIYVDKNDKGEGTLERSKKDSFNWYKKVIESNGKD
LD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacactatgcctaagggctttttatggggcggcgctgttgctgctcaccaa
cttgaaggtgcatgggatgaagatggaaagggaatgtctgtagcggatgttatgacagta
ggatcagccactaagccgcgtgaaattactgatggcgttattcctggtaaaaactatcct
aatcatgaggccattgatttttaccatcactacaagggtgatattaagttaatggctgaa
atgggctttaaagcttttcgtacttcaatagcttggactagaatttttcctaaaggcgat
gaagaagaacctaatgaagcaggtcttaagttctacgatgacttatttgatgaatgtcat
aagtatggaattgaacctgtaattaccctttctcactttgaaattccttatcacttagtc
aaagaatatggtggttttactaaccgtaaattaattgattactttgttcgctttgcccgt
gtttgctttaagcgttacaagaataaagttaaatactggatgactttcaacgaaattgat
aatcaatctagttttaacaatgacttcttaatggctactaactctggtatcttgtttaag
aacggaatgggcgataaagaaaaagaagctgctatgtatcaagcagcccactatgaatta
gttgcttctgctttagcagttaaagaaggccacaagattaatccagactttcaaattggt
tgtatgattaattactcacctgttcgtcctctaactccatcatcagatgatgttttactt
gctgataagtttgaacaaagacgtgacttcttctctgatgtccacgttaatggtgaatat
ccaaatgctgttgaagactatatcgaaagaaatggctaccgtccagatatcactgaagaa
gataaaattgccttaaaagaaggtacagtagactacgttggtttctcatactatcaatcc
actactgtttcaaataagaaagttaaaccagatgaattaactgacttacaagaagctatc
gtcgaaaaccctactttagagcgtagtgactggggttgggaaattgatccagaaggtttg
agaatctctcttaaccacctaactgaccgctaccacaagccactatttatcgttgaaaat
ggtctcggtgcttacgacaaacgtgaagctgacgggtcagttcatgatccatatcgaatc
gattacttgagaaaacacattgaacaaatggaaaaggccgttgtgttagatggtgttgac
ttgatgggttatcttccttggggatgcatagacttagtttcagctggaacgggtcaaatg
gacaagcgttatggcttcatctatgttgacaagaatgacaagggtgaaggaacgctagaa
cgctcaaagaaggattcatttaactggtataagaaagttattgaatctaacggtaaagat
ttagactaa

DBGET integrated database retrieval system