KEGG   Lactobacillus johnsonii DPC 6026: LJP_0270Help
Entry
LJP_0270          CDS       T01960                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ljh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ljh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ljh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301668..303866
Genome map
AA seq 732 aa AA seqDB search
MNQLINFDKKNKVFHLHNDQISYLLAVEDGNTLAHVYFGKTIKQYHGQLRYPRVDRGFSG
NLPSSLDRTFSRDSLPKEYSTAGEMDYHTPAAVVRQKDGSNALFLTYQDYKIVAGKPDLA
GLPHSFVENNDEAETLIVNSLDEKSKVEFELAYTIYRDRPVITRSVKVVNKGEETVNIEK
VASMQIDFVDRNFESITLPGAHAHERRVERSEINQGIHVYSSHRGTSSHQMNPFMALVDK
DTTEFSGDAYGFAFVYSGNHKFEVEKDQFAQTHVNIGIDDFNFSWELTPNSSFQTPEVLM
TYSAQGLNKMSQAFHSLIHDRVIRSKYKDRVRPILVNNWEATYFDFDEEKLKPIVDDAKE
MGIEMFVLDDGWFGHRDDDNSSLGDWSVFEKKFPHGLDHFADYVHEQGLKFGLWFEPEMI
SMDSNLYQEHPDYLMHVPGRTPSPSRNQYVLDLGRKEVRDNIFEQMNKILESGKIDYIKW
DMNRHLSDIYEADLPAARQGETYHRYVLGLYDLLERLVNSYPDLLIEGCSGGGGRFDAGM
AYYNPQIWASDDSDAIDRLSIQYGTSLAYPQSMMTSHVSVSPNEQNGRITPFKTRGIVAM
WGDLGYELDLTKMSKEDRQAVKEQVAEYKKIREVTQYGTFYRLKSAQTSNQCAWETVSKD
KTEAVLSVVKVMASAQPYLTKTKMVGLAPEKHYEDQNTHEVYGGDELMNLGIYDPVEHGD
FKAYIYHFKAID
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaactaattaattttgataaaaaaaataaagtttttcatttacataatgatcaa
atttcatacttattagcagttgaagatggaaatacactagctcatgtgtattttggtaaa
acaattaaacaatatcatgggcaattacgctatccgcgagtagaccgaggcttttctggt
aatttaccgagctcactagatagaactttttcacgtgattctttaccaaaagaatacagt
acagctggtgaaatggattaccatactccagcagcagtagttcgccaaaaggatggatct
aacgcactatttttgacttaccaagattataaaattgtagcaggtaagccggatttagca
ggattgccacattcctttgttgaaaataatgatgaagctgaaactttaatcgtcaattca
cttgatgagaagagtaaagttgaattcgaattggcatatactatttaccgtgatcgtcca
gtaattactcgttcagtcaaggtagttaataagggcgaggaaacagttaatattgagaaa
gttgcttcaatgcagattgactttgtagaccgtaactttgaatcaattacgttgcctggt
gctcatgcacatgaaagacgcgttgaacgtagtgaaattaatcaaggcattcatgtttac
tctagtcatcgcggtacgtctagccaccaaatgaatccatttatggctttagttgataaa
gatactactgaattttctggggatgcttatggttttgcctttgtttactccggtaatcac
aaatttgaagtagaaaaagatcaatttgcacaaacccatgtcaatatcggtattgatgat
ttcaactttagctgggaactaacaccaaattctagtttccaaactccagaagtattgatg
acatactctgctcaaggcttgaacaaaatgagccaagcatttcacagtttaattcatgat
cgtgtcattagaagtaaatataaagatcgagttcggccaattttagtaaacaactgggaa
gctacctattttgattttgacgaagaaaaattaaagccaattgttgatgatgcgaaggaa
atgggcattgaaatgtttgttcttgatgatggttggtttggccatcgtgatgatgataat
tcttcattaggagactggagtgtttttgaaaagaaattcccacatggattagatcatttt
gcagattatgttcatgaacaaggattaaaatttggtctttggtttgaaccggaaatgatt
tcaatggattcaaacttatatcaagagcatcctgattatttaatgcatgttccaggaaga
actccaagcccatctcgtaatcaatatgttcttgatctaggtagaaaagaagttcgtgat
aatatctttgaacaaatgaacaagattcttgaatcaggcaagattgattacatcaagtgg
gatatgaatcgtcacttgtcagatatttatgaagcagatttaccagctgcaagacagggg
gaaacttaccaccgttatgtcttaggactctatgacttgcttgaaagattagttaattct
tatcccgatttattaattgaaggttgttctggcggaggcggacgctttgatgcgggtatg
gcatattacaacccacaaatttgggctagtgatgatagtgacgcaattgatagattaagt
attcaatatggtactagtttagcttatccacaatcaatgatgacttctcatgtttcagtt
agtccaaatgaacaaaatggtcgaattacaccatttaagacacgtggaattgtagcaatg
tggggtgatttaggttatgaacttgatttaactaagatgagcaaagaagatcgtcaagca
gttaaagaacaggtggcagaatataaaaaaattagagaagttactcagtatggcactttt
tatcggttaaagagtgctcaaaccagtaatcaatgtgcctgggaaactgtttcaaaagat
aaaactgaagctgttttatcagtagttaaagtaatggcaagtgctcagccatatttaact
aagaccaagatggtcggacttgccccagaaaagcactatgaagatcaaaatactcatgag
gtatacggcggggatgaattgatgaatttaggaatttatgatccagtcgaacacggtgat
ttcaaggcctatatttatcactttaaagcaatagattag

DBGET integrated database retrieval system