KEGG   Lactobacillus johnsonii DPC 6026: LJP_0270Help
Entry
LJP_0270          CDS       T01960                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LJP_0270
  Lipid metabolism
   00561 Glycerolipid metabolism
    LJP_0270
   00600 Sphingolipid metabolism
    LJP_0270
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LJP_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301668..303866
Genome map
AA seq 732 aa AA seqDB search
MNQLINFDKKNKVFHLHNDQISYLLAVEDGNTLAHVYFGKTIKQYHGQLRYPRVDRGFSG
NLPSSLDRTFSRDSLPKEYSTAGEMDYHTPAAVVRQKDGSNALFLTYQDYKIVAGKPDLA
GLPHSFVENNDEAETLIVNSLDEKSKVEFELAYTIYRDRPVITRSVKVVNKGEETVNIEK
VASMQIDFVDRNFESITLPGAHAHERRVERSEINQGIHVYSSHRGTSSHQMNPFMALVDK
DTTEFSGDAYGFAFVYSGNHKFEVEKDQFAQTHVNIGIDDFNFSWELTPNSSFQTPEVLM
TYSAQGLNKMSQAFHSLIHDRVIRSKYKDRVRPILVNNWEATYFDFDEEKLKPIVDDAKE
MGIEMFVLDDGWFGHRDDDNSSLGDWSVFEKKFPHGLDHFADYVHEQGLKFGLWFEPEMI
SMDSNLYQEHPDYLMHVPGRTPSPSRNQYVLDLGRKEVRDNIFEQMNKILESGKIDYIKW
DMNRHLSDIYEADLPAARQGETYHRYVLGLYDLLERLVNSYPDLLIEGCSGGGGRFDAGM
AYYNPQIWASDDSDAIDRLSIQYGTSLAYPQSMMTSHVSVSPNEQNGRITPFKTRGIVAM
WGDLGYELDLTKMSKEDRQAVKEQVAEYKKIREVTQYGTFYRLKSAQTSNQCAWETVSKD
KTEAVLSVVKVMASAQPYLTKTKMVGLAPEKHYEDQNTHEVYGGDELMNLGIYDPVEHGD
FKAYIYHFKAID
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaactaattaattttgataaaaaaaataaagtttttcatttacataatgatcaa
atttcatacttattagcagttgaagatggaaatacactagctcatgtgtattttggtaaa
acaattaaacaatatcatgggcaattacgctatccgcgagtagaccgaggcttttctggt
aatttaccgagctcactagatagaactttttcacgtgattctttaccaaaagaatacagt
acagctggtgaaatggattaccatactccagcagcagtagttcgccaaaaggatggatct
aacgcactatttttgacttaccaagattataaaattgtagcaggtaagccggatttagca
ggattgccacattcctttgttgaaaataatgatgaagctgaaactttaatcgtcaattca
cttgatgagaagagtaaagttgaattcgaattggcatatactatttaccgtgatcgtcca
gtaattactcgttcagtcaaggtagttaataagggcgaggaaacagttaatattgagaaa
gttgcttcaatgcagattgactttgtagaccgtaactttgaatcaattacgttgcctggt
gctcatgcacatgaaagacgcgttgaacgtagtgaaattaatcaaggcattcatgtttac
tctagtcatcgcggtacgtctagccaccaaatgaatccatttatggctttagttgataaa
gatactactgaattttctggggatgcttatggttttgcctttgtttactccggtaatcac
aaatttgaagtagaaaaagatcaatttgcacaaacccatgtcaatatcggtattgatgat
ttcaactttagctgggaactaacaccaaattctagtttccaaactccagaagtattgatg
acatactctgctcaaggcttgaacaaaatgagccaagcatttcacagtttaattcatgat
cgtgtcattagaagtaaatataaagatcgagttcggccaattttagtaaacaactgggaa
gctacctattttgattttgacgaagaaaaattaaagccaattgttgatgatgcgaaggaa
atgggcattgaaatgtttgttcttgatgatggttggtttggccatcgtgatgatgataat
tcttcattaggagactggagtgtttttgaaaagaaattcccacatggattagatcatttt
gcagattatgttcatgaacaaggattaaaatttggtctttggtttgaaccggaaatgatt
tcaatggattcaaacttatatcaagagcatcctgattatttaatgcatgttccaggaaga
actccaagcccatctcgtaatcaatatgttcttgatctaggtagaaaagaagttcgtgat
aatatctttgaacaaatgaacaagattcttgaatcaggcaagattgattacatcaagtgg
gatatgaatcgtcacttgtcagatatttatgaagcagatttaccagctgcaagacagggg
gaaacttaccaccgttatgtcttaggactctatgacttgcttgaaagattagttaattct
tatcccgatttattaattgaaggttgttctggcggaggcggacgctttgatgcgggtatg
gcatattacaacccacaaatttgggctagtgatgatagtgacgcaattgatagattaagt
attcaatatggtactagtttagcttatccacaatcaatgatgacttctcatgtttcagtt
agtccaaatgaacaaaatggtcgaattacaccatttaagacacgtggaattgtagcaatg
tggggtgatttaggttatgaacttgatttaactaagatgagcaaagaagatcgtcaagca
gttaaagaacaggtggcagaatataaaaaaattagagaagttactcagtatggcactttt
tatcggttaaagagtgctcaaaccagtaatcaatgtgcctgggaaactgtttcaaaagat
aaaactgaagctgttttatcagtagttaaagtaatggcaagtgctcagccatatttaact
aagaccaagatggtcggacttgccccagaaaagcactatgaagatcaaaatactcatgag
gtatacggcggggatgaattgatgaatttaggaatttatgatccagtcgaacacggtgat
ttcaaggcctatatttatcactttaaagcaatagattag

DBGET integrated database retrieval system