KEGG   Lactobacillus johnsonii DPC 6026: LJP_0376Help
Entry
LJP_0376          CDS       T01960                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LJP_0376
Enzymes [BR:ljh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LJP_0376
Amino acid related enzymes [BR:ljh01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LJP_0376
Transfer RNA biogenesis [BR:ljh03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LJP_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425116..426615
Genome map
AA seq 499 aa AA seqDB search
MAKQKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVEGGSKSQ
MENLHWLGIDWDEGPDKGGDFGPYRQSERKDIYNKYIQQLIDEGKAYYSYKTEEELEAQR
EEQRAMGIAPHYTYEYEGMTADEIKEAQAAAEAKGLKPVVRIHIPENRTYAWEDMVKGKV
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEITHVLRGDDHVANTPKQLVVYEALGW
EPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPDAMFNFITLLGWSPVGESE
IFSQRELIKSFDPKRLSKSPAAFDQKKLEWINNQYVKKADRDLLLDLALNNLQEAGLVDK
EISPEKMEWVRQLVNIYAVQMSYTKQIVDIAKIFFEEAPELSDAEIEEIKKDDARPVIEE
FKKQLNAVPRFTAVQAMNAIQATRRETGVKGRKLFMPIRIAATRSMVGPGIGEAIELMGK
EKVNKHIDLTLKQLSDLGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacaaaaaatccgcgttcgttacgcaccaagtccaacaggtcacttgcacatt
ggtaacgcacgtactgcattatttaactatctatttgcacgtcacaataaagggacaatg
gtcttaagaattgaagatacggaccaaaaacgtaacgttgaaggtggttctaagtcccaa
atggaaaacttgcactggttaggtattgactgggatgaaggtcctgataagggtggcgac
tttggcccttaccgccaatcagagcgtaaagatatttacaataaatatattcaacaatta
attgatgaaggtaaagcttactattcatacaagactgaggaagaacttgaagcacaacgt
gaagaacaacgtgcaatgggaattgctcctcactacacttatgaatatgaaggcatgacc
gctgatgaaattaaagaagctcaagcagctgcagaagcaaaaggcttaaagccagttgtt
cgtatccacattcctgaaaatagaacttatgcttgggaagatatggttaagggtaaggta
tcatttgaatcagatactatcggtggtgacttcgttattcaaaaacgtgatggtatgcca
acctacaactttgccgttgtaattgatgaccacctaatggaaattactcacgttcttaga
ggggacgaccacgtagctaacactcctaagcaattagttgtttatgaagcacttggctgg
gaaccacctaagtttggtcacatgactttgatcattaactctgaaactggtaaaaaactt
tctaagcgtgatgaatcagttcttcaatttattgaacaataccgtgaccttggttactta
ccagacgcaatgttcaactttattaccttacttggctggtctcctgttggtgaaagtgaa
attttctcacaaagagaattaattaagtcatttgatcctaagcgtttatctaagtcacca
gctgcctttgaccagaagaaacttgaatggattaacaaccaatacgttaagaaggcagac
cgtgatcttttattagatcttgctttgaataacttacaagaagcaggtttagttgataaa
gaaatttcaccagaaaagatggaatgggttcgtcaattagtaaatatttacgctgtacaa
atgtcttatactaagcaaattgtagatattgctaagatcttctttgaagaagctccagaa
ttatctgatgcggaaattgaagaaatcaagaaagacgatgctcgtcctgtaattgaagaa
ttcaagaagcaattaaatgctgttcctcgctttactgctgtacaagctatgaacgcaatt
caagctactcgtcgtgaaactggggtaaagggtagaaaattatttatgccaattagaatt
gctgctactcgttcaatggttggacctggtattggtgaagctattgagttaatgggtaag
gaaaaagttaacaagcacattgacttaactttaaagcaattaagtgatttaggtctttaa

DBGET integrated database retrieval system