KEGG   Lactobacillus johnsonii DPC 6026: LJP_0405Help
Entry
LJP_0405          CDS       T01960                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJP_0405
DNA repair and recombination proteins [BR:ljh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LJP_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448739..449338
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDNYMKLPGIGEKTATRLAFYTMDMPEQDVEDFSKSLMQVKENLHSCSIC
GNITESDPCEICRDSNRDRSTIMVVEQPKDVMAFEEMGEYNGLYHVLHGILSPMDGVGPE
EINIKSLITRLQKQDEVKEVILALNSSPEGEATAMYLAKLIKPAGLKVTRLAAGLAVGSD
IEYANSITLKRAVQGRTDL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccattaccaattgcccgtttaattgataattacatgaagctgcctggtatt
ggtgaaaaaacagcaacacgtttagccttttacacaatggacatgccagaacaggatgtg
gaagacttttctaagtcattaatgcaggtaaaagaaaaccttcattcttgttctatttgt
gggaatattactgaaagtgatccatgtgaaatttgccgcgattcaaaccgtgaccgttca
acgataatggtagttgagcaaccaaaagatgtcatggcttttgaggaaatgggtgaatat
aatggcttgtaccatgtcttacatggaatcttgtccccaatggatggagtaggaccagaa
gaaattaacattaaaagtttaattaccagacttcagaaacaagatgaagttaaagaagtc
attcttgccctaaactccagcccagaaggtgaagcaactgctatgtatctagctaagcta
attaagccagctggcctaaaggtaacgcgtcttgctgctggtttagccgtaggtagcgat
attgaatacgcgaactcaattactttgaagcgcgctgttcaagggagaacagatctatga

DBGET integrated database retrieval system