KEGG   Lactobacillus johnsonii DPC 6026: LJP_0453Help
Entry
LJP_0453          CDS       T01960                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJP_0453
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LJP_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499782..500360
Genome map
AA seq 192 aa AA seqDB search
MFEYLKGIVTKIDPAYIVLDVNGVGYKILCPTPYSYDENQPATIYVEQVVRDTGITLYGF
LSLEDKELFLKLLSVSGIGPKSAVAIMAAEDTDSLASAIQNGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVKKSTAAADLTPSLQDALLALVALGYTQKEVDRITPKLAKLPENTADG
YVKEALALLLKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctcaagggaatagtaacaaaaattgatccagcttatatcgttctagat
gtaaacggagttggctataagattctttgtcccactccttatagttatgatgaaaatcaa
cctgcaacaatttacgttgagcaagttgtaagagataccggaattactttgtatggtttt
ttgtctttagaagataaagaattatttttaaaattattaagtgtttcaggaattggacct
aagtctgctgtggcaattatggctgctgaagatactgattctttggctagtgcaattcaa
aatggtgaagtaaaatacctgactcgtttcccaggagtaggaaaaaagactgcttcccag
attgtcttagacttgaagggaaaactaggcgactatgtaaaaaaatcaactgctgctgcc
gatcttactccaagtctgcaagatgctttacttgccttagtagcacttggttatacccaa
aaagaagttgatcgaattacgccaaaattagcaaaattacctgaaaatactgctgatggt
tacgttaaagaagcattagctttactacttaagaaataa

DBGET integrated database retrieval system