KEGG   Lactobacillus johnsonii DPC 6026: LJP_0525Help
Entry
LJP_0525          CDS       T01960                                 

Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJP_0525
   00330 Arginine and proline metabolism
    LJP_0525
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LJP_0525
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LJP_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585650..586570
Genome map
AA seq 306 aa AA seqDB search
MIQLEKLVKKNLPKEKEGKVASYIPALAEVNPKQLGVALYDLEDGEVGEAGQSEVRFAIE
SISKVITLMLAIKKMGIQEVFKHVGSRQTGFAFNSILNMEIERAKYPLNPFINAGAIATT
SMVVSKTGDDAFEEILDFVRDICNDPDLYLDQIIYHSEKRTGNLDRSLAYYMESKNMMLG
DVVTSLDTYFKQCSMMVTARSLANLGAVLANGGVKPWDNKRIIPDEEARCIKSLMMTTGL
YNQSGTYSRLIGVPTKSGVGGGLMSAAPHKYGIGIFSPALDKDGNSIAGLDLLRDIVDGL
ELDIFD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattagaaaaattagttaagaaaaatttacctaaagaaaaagaaggaaaagtt
gctagctatattccagctttagctgaagttaatcctaagcagctcggagttgctttatat
gatttagaagatggtgaagtaggtgaagcaggccaaagcgaagtacgttttgcaattgaa
agtatttctaaggtaattaccttaatgcttgctattaaaaagatgggcatacaagaagta
tttaaacatgtaggctcccgtcaaacaggctttgccttcaattcaattctaaatatggaa
attgaaagagctaagtatccgttgaatccttttattaacgctggagcaattgctacaact
tcgatggtagtaagtaagacgggtgacgatgcatttgaagaaatcttagattttgttcgt
gatatttgtaatgacccagatctttacttagatcaaataatttatcattctgaaaaaaga
acaggcaatctagaccggtcgttagcatattatatggaatctaaaaacatgatgctgggg
gatgtagtgactagtcttgatacttactttaagcagtgttcaatgatggtgactgcacgt
tctttagcaaatttaggggctgttttagctaatggcggtgtaaaaccatgggacaacaaa
cgcattatccctgatgaagaagctcgttgtatcaagtcattaatgatgacaactggccta
tataatcaatcaggcacctattcacgactaattggtgtaccaacaaagagtggtgttggt
ggtggtcttatgtccgctgcacctcacaaatatggaattgggatctttagtccggcctta
gataaagatggtaacagtattgcaggcttagatttattgagagatattgttgatggatta
gagctagatatatttgattag

DBGET integrated database retrieval system