KEGG   Lactobacillus johnsonii DPC 6026: LJP_0628Help
Entry
LJP_0628          CDS       T01960                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LJP_0628
   00052 Galactose metabolism
    LJP_0628
   00500 Starch and sucrose metabolism
    LJP_0628
   00520 Amino sugar and nucleotide sugar metabolism
    LJP_0628
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LJP_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690351..691256
Genome map
AA seq 301 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNK
RSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSF
VGDEPFAVMLGDDLMDDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDSEIE
PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLREYIINMAQKLQKEDKNSKK
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagttattccagcagctggattaggtactagatttttacctgcc
actaaggctatgcctaaggaaatggtaccgattgttgataaaccaacaattcaatttatt
gtagaagaagctaaaaaatctggaattgaggatatcttgatcgttactggtaaaaacaag
cgttctatcgaagatcactttgatgctaacccagaactagaacaagatttggaagaaaag
ggtaagactgaacttttacacttaacccaatcaattactaacttaggtgttaacctttac
tacactcgtcaaccacacccagctggtttaggggatgcgattttaagagctcgtagcttc
gttggggatgaaccatttgctgttatgcttggtgacgacttgatggatgacaaggttcca
ctaactaagcaattgatcgatcgctatgacaagactcatgcatcaactattgctgttatg
cctgtaccacatgaagaagtttctaagtatggtgttattgatccagatagcgaaattgaa
cctggtttaattaacgttaaggcctttgttgaaaagccagacgttgataaggcacctagt
gactacgcaattattggtcgttacttgttaactcctgaaatttttgatattttagcacat
caaaaacctggtcgtggtggcgaaattcaattaactgacgcaattgatactatgaacaag
actcaacgagtattcgctcatgtatttaatggtgaacgtcacgatgttggtaacaaggaa
ggttaccttgaaacatcaattgaatatggtttatctcaccctcaaattaaagatgattta
cgtgagtacattattaacatggctcaaaaattacaaaaagaagataaaaactcaaagaag
aaataa

DBGET integrated database retrieval system