KEGG   Lactobacillus johnsonii DPC 6026: LJP_0677Help
Entry
LJP_0677          CDS       T01960                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ljh00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740708..741322
Genome map
AA seq 204 aa AA seqDB search
MAHQGLLLVLSGPSGVGKGTVKSAMVKQKAFSFEYSVSMTTRKPRPGEVNGKDYYFVSED
RFQEAIKGNELLEYNEYVGNHYGTPLAPVQKMLNEGKDVLLEIDVNGAKQVRKLMPDGVF
IFLTPPDLHELKHRIVNRGTDSDKVIAMRMKQARKEILMMEDYDYAVVNDTVANAVDHIK
SIVEAEHVRVPRVINDYRNMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcaaggtttattattagttttatctggtccttctggcgttggtaaggggacc
gttaaaagtgcaatggtgaagcaaaaagctttttcatttgaatattctgtttcaatgact
actcgtaagcctcgtccaggcgaagttaatgggaaggattattattttgtttcagaggac
cgtttccaagaagcaattaaaggtaacgagcttttggaatataatgaatatgtaggcaac
cattatggtactccacttgcaccagtgcaaaagatgctcaatgaaggtaaagatgtttta
cttgaaattgatgtcaatggagcaaaacaggttcgcaagttaatgccagatggcgtcttt
atctttttgacaccaccagatttgcatgaattaaaacatcgaattgttaatcgcgggact
gattctgacaaggtaattgccatgagaatgaaacaggcacgtaaagagattttaatgatg
gaagattatgattatgctgtagttaacgatactgttgctaatgcggtggatcatattaag
tctattgttgaagctgaacacgtgcgtgtaccgcgagtaattaacgattatagaaatatg
gttaaggaggattaa

DBGET integrated database retrieval system