KEGG   Lactobacillus johnsonii DPC 6026: LJP_0759Help
Entry
LJP_0759          CDS       T01960                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LJP_0759
   00670 One carbon pool by folate
    LJP_0759
Enzymes [BR:ljh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LJP_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833763..834266
Genome map
AA seq 167 aa AA seqDB search
MIRFIWAEDENGCIGYQGALPWHLPADLKHFKELTSNHIIVMGRKTFDSFPGLLPKRKHI
ILSTNTILQRKYQDNSRVKVFSQIKQLKNWIEDHTEETIDIIGGAEVFKEFKDEVDVLEK
TKIHHIFKCDTWMPELKYEDFKLVNSESHHPNGNNKFDYDFLEYKRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgattagatttatttgggcagaagatgaaaatggatgtattggttaccaaggtgctttg
ccctggcatttgcccgctgatttaaaacattttaaagagctgactagtaatcatattatc
gttatgggacgaaaaacatttgatagttttccaggattacttcctaaaagaaaacatatc
atcctttctactaatacaattttacaacgtaaatatcaagataattcacgagttaaagtt
ttttcacaaattaaacagttgaaaaattggatcgaagatcacactgaagaaacaattgat
attattgggggtgctgaagtttttaaagaatttaaggatgaagtagatgttcttgaaaag
acaaaaattcaccatatatttaagtgtgatacatggatgccggaactaaagtacgaagac
tttaaattagtaaattccgaaagtcatcatccaaatggaaataataaatttgattacgac
tttttagagtataagagaatataa

DBGET integrated database retrieval system