KEGG   Lactobacillus johnsonii DPC 6026: LJP_0901Help
Entry
LJP_0901          CDS       T01960                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LJP_0901
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJP_0901
Enzymes [BR:ljh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LJP_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961962..962918
Genome map
AA seq 318 aa AA seqDB search
MENLNLVSLPHFVSVENLSVEEVEALINRAEYFKNGGATPNLTEPICITNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLIMEAVGVNIEVIRHSQNEYYQNLIR
PQDHQHLDIGIINAGDGSGQHPSQCLLDMMTIHEHFKQFKGLKVAIVGDITNSRVAKSNM
ELLHRLGAEVYFSGPEYWYSKEFDKYGKYEELDKLIPEMDVMMLLRVQHERHSDDPNEKN
FDAKAYHEKYGINKGRYQALKPNAIIMHPGPINHDVELSADLVESDKCMFTRQMQNGVFM
RMAMIEAVLRGRKLGGLK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaaatcttgttagtttaccacattttgttagtgtagaaaatctgagtgtt
gaagaagttgaagctttaattaatcgagcagaatattttaaaaatgggggagcgacgcct
aatctaacagagcccatctgtattactaatatgttttttgaagattcaagtagaacgcat
actagttttgaaatggctgaaagaaaattaggtttaaccgtaatcccatttgatcctgct
cattcttcagttaataagggagaaacattatatgatacatccctgattatggaagctgtg
ggagtgaatattgaagtaattcgtcactcacaaaatgaatactatcaaaatttaatccgc
cctcaagatcatcaacatttagatattggaataattaatgccggagatggcagtggacaa
catccaagtcaatgtttgttagacatgatgacaattcatgaacattttaagcaatttaaa
ggtctaaaagtagctattgttggcgatattactaattcacgagttgctaaaagtaatatg
gaattactccaccggttaggagctgaagtttacttttcaggacctgaatattggtactcg
aaggaatttgataagtatggaaaatatgaagaactagataagctaattcccgagatggat
gtgatgatgctcttaagagttcaacatgaaagacacagtgatgatcctaatgaaaagaat
tttgatgcaaaagcatatcatgaaaaatacggaattaataaggggcgctatcaagcatta
aagccgaatgcaattattatgcacccaggcccaattaaccacgatgttgaattaagtgca
gatttggtggaaagcgacaagtgtatgtttactcgtcaaatgcaaaatggtgtgtttatg
agaatggcaatgattgaagcagtcttacgaggaagaaaattaggaggactcaagtaa

DBGET integrated database retrieval system