KEGG   Lactobacillus johnsonii DPC 6026: LJP_1085cHelp
Entry
LJP_1085c         CDS       T01960                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJP_1085c
   01230 Biosynthesis of amino acids
    LJP_1085c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_1085c
   00030 Pentose phosphate pathway
    LJP_1085c
   00051 Fructose and mannose metabolism
    LJP_1085c
   00052 Galactose metabolism
    LJP_1085c
  Energy metabolism
   00680 Methane metabolism
    LJP_1085c
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LJP_1085c
Protein phosphatases and associated proteins [BR:ljh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LJP_1085c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172063..1173022)
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADK
ISRGGTFLYSARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTSHGYNAI
GLPGSIDNDIPYTDYTIGFDTACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHV
GVATGADAIVIPEEPYDIKEIAENLKQGFANGKKHGIVVLAEGVMDAEKFKDELLKYGDF
DARANVLGHMQRGGSPTMRDRVVASEMGAYAVKLLLEGKGGLAVGMENNKLTHHDILDLF
DAKHHGNYALYSLNKDLAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagatgcccctggtatgaacgctgccatt
agagctgttactcgtacagctttggcaaacggtatcgaagtttgcggaattcgttatgga
tatgctggtttagttgctggtgatattttccaaatgacttctgaaacagttgcggataaa
attagccgcggcggtacttttctttattcagctcgtttcccagaatttaaggaagaagaa
gttcaacttaagggaatcgaacaattaaagaagcacggaatcgatgctttagttgtcatt
ggtggtgatggttcttaccacggtgcattgaagcttacaagccatggctataatgctatt
ggtcttcctggttcaattgacaacgatattccttatactgattacacaattggttttgac
actgcatgtaatactgcaatggaagccattgataagattcgtgacactgcaacaagtcac
caacgtgtatttgttgtaaatgttatgggtcgtgattgtggggatatcgcaatgcacgtt
ggtgttgctaccggtgctgacgcaattgttattccagaagaaccttatgacattaaggaa
attgctgaaaacttgaagcaaggatttgctaatggtaagaaacatggaatcgttgtttta
gctgaaggtgttatggacgctgaaaaatttaaggatgaacttcttaaatatggtgacttt
gacgctcgtgctaatgtattgggccatatgcaacgtggcggaagcccaacaatgcgtgac
cgtgtagtagcaagtgaaatgggtgcctacgctgttaagttattacttgaaggtaaaggc
ggcttagctgttggtatggaaaacaacaagcttactcaccatgatattcttgatttgttt
gatgcaaaacaccacggtaattatgcgttatactcattaaacaaagacttagccaagtag

DBGET integrated database retrieval system