KEGG   Lactobacillus johnsonii DPC 6026: LJP_1112cHelp
Entry
LJP_1112c         CDS       T01960                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ljh00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ljh00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1209624..1210232)
Genome map
AA seq 202 aa AA seqDB search
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKG
VLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSDSKTYGKWYGVELTAENKKQFLIPQGF
AHGFLVLSDEAEFCYKVNDFWHQNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDD
GTKLTLSDRDQEWKGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaattaaagttgaaaaaaatgttggtggaattgaaggtttagcagttatcacc
ccaactgttcacggtgatgatcggggttacttcatggaaacttttaaccaaagagatatg
atggatgctggcttcagcattaatttcgttcaagataaccaatcaagctcaactaagggt
gtgcttcgtggtttgcacttccaaaagaaatacccacaaattaagttggttcgtgctgtt
cgtggtagtgtctttgatgttgctgttgaccttcgtagcgactcaaagacttacggtaag
tggtatggtgttgaattgactgctgaaaacaagaagcaattcttaattccacaaggtttt
gctcatggtttccttgttttaagtgatgaagcagaattctgctacaaggttaacgatttc
tggcaccaaaacgatgaaggtggtatggcttggaatgatcctgaaattggtatcgaatgg
ccacatcttaagggtgattacccaggcagtccagatgctagtggttacactcttgatgat
ggtactaagcttactttatctgaccgtgatcaagaatggaaaggcttaaaggatactttt
aagttttaa

DBGET integrated database retrieval system