KEGG   Lactobacillus johnsonii DPC 6026: LJP_1165cHelp
Entry
LJP_1165c         CDS       T01960                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJP_1165c
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LJP_1165c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1259368..1261743)
Genome map
AA seq 791 aa AA seqDB search
MAETSFTGRINGIVFENNQDLFKIIDVDLISKLPDYDRDNIRVTGNFGDIQIGSTYKFTG
NIVVHEKFGKQFRIRSYEPVLPHEEGSLAKYLSSDKFPGIGKRAAEKIIDSLGTNALDLI
KSNQTEIDNLDLTQKQKDSLLSGINQMDSFSEIVIKLARYGINKKVAGNIYKVYHGDSLK
KLEEDPYQALGEVRGFGFKTADNMGHALGIELNDPRRVRGALLSILQTALNTLGDTYVAL
DELLTQAYDLVQSTSYDELANSVNELQRQGKVVVSGDKAALQTIFQTELDIATELKHVVN
NQVEKEEFDDSDIEKAIKHVEETLEIEYDDTQKNAIKNALNNPISILTGGPGTGKTTIIN
GILMCLKELAEIPSAALYSDDPPFLLAAPTGRAAKRMSEVTDISAKTIHRLLGLGIGENE
ATDVNELNGEILIIDEMSMVDMFLFKQLLSGINSTKRIVFVGDKDQLPSVGAGNVFSDLI
SSGAFPTTKLQVIHRQGEDSSIIKLAHAINDEEAEETIFNKTKNYSFIPCQPSLVGDAID
QIVNLAIKRGFKKDDVQVLGAMYNGQGGITHLNDILQDVMNPLSAKTKVIEAHNESFRIG
DRILQLQNNPEKDIYNGQIGKIIGLNPDDKAKILIADFDGREIEFGIKDLNDITRAYAIT
IHKSQGSEFPLVILNLTMQNYMMLRRNLLYTAITRAEKNLVMVGEKKAYIMALRTPGNDR
KTELAAKIRYELGLKEVENTSNVNAEQEKTKTEVKEENVEPEDYILTPELIYSGQIDPMI
GMEDIKLEEKR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactagttttactggacgaataaatggaattgtttttgaaaacaatcaagat
cttttcaagattattgatgtagatttaatcagtaaattacctgattacgatcgtgataat
atccgagtaactggaaattttggggatatccaaattggatcaacttataaatttaccggt
aatattgtcgtgcacgaaaaatttggtaaacaatttcgtataaggtcttatgaaccagtt
ttgcctcatgaagagggtagtttagctaaataccttagttctgataagtttcctggaatc
ggtaagagggctgctgaaaagatcattgatagtttaggaacaaatgcgttagatttgatt
aagtcaaatcaaactgaaattgacaatcttgatttgacccaaaagcaaaaggatagctta
ttatctggaattaatcagatggattctttttcagagattgtgattaagctggctagatat
gggattaataaaaaagtagccggtaatatttataaagtgtatcatggtgattccttgaag
aaactagaggaagatccttatcaagcccttggtgaagttcgcggctttgggtttaaaact
gcggataatatgggacacgcgctcggaatagaactaaatgatcctagaagagttagggga
gcacttctaagtattttacagactgctcttaataccttgggagatacttatgttgcactt
gatgaattattaacacaggcttatgatttagttcaatctacctcttatgatgagcttgct
aatagtgttaatgaacttcaaaggcaaggaaaagttgttgtttcaggtgataaggcagct
ttgcagacaatttttcaaactgaacttgatatagccactgaattaaaacatgtagttaat
aatcaagtcgaaaaagaagaatttgatgatagcgatattgaaaaagcaataaagcatgtc
gaagaaacacttgaaattgaatatgatgatactcaaaaaaatgcaattaaaaatgcgtta
aataatccaatttcaattcttactggtggtcctggtactggtaaaacgacaattatcaat
ggaattttaatgtgcttaaaggaacttgcggaaattccaagtgcagctttgtatagcgat
gatccaccatttttacttgctgcaccaacgggtcgagctgccaagcgaatgagtgaggtt
acagatatttcagcgaaaaccattcaccgtttattagggttaggcatcggtgaaaatgaa
gcgactgatgtaaacgaattaaacggtgagatcttaattattgacgaaatgtcgatggtt
gatatgtttctctttaaacagcttttatccggtattaattcaacaaagaggatagttttt
gttggggacaaagaccagcttccttcagttggagcagggaatgtttttagtgatttaata
agttcaggggcatttccaactacaaagttgcaagtaattcatagacagggagaagactcc
tcaattattaagttggcccatgcaattaatgatgaagaagcagaagagactatttttaat
aaaactaaaaattactcctttattccatgtcaaccaagcttggtgggggatgcaatcgat
caaatcgtaaatttggctattaaacgtggtttcaaaaaggatgatgttcaagttctggga
gcaatgtacaatggtcaaggtggaattactcacttgaatgatattttgcaggatgtgatg
aatccactgtcggcaaaaactaaagtaattgaagctcacaatgaaagttttagaatcggg
gaccgaatcctacaattacaaaataatccagaaaaagatatttataatggtcaaattggt
aaaattattggccttaatcctgatgataaagccaaaatattaattgctgattttgacggt
cgtgaaatagaatttggtattaaagacttaaatgatattacccgtgcgtatgccattact
atccataagtcccaaggatcagaatttccgttagtaattttaaatcttacgatgcaaaat
tatatgatgttgaggcggaatttgttatataccgccattactcgtgccgaaaaaaactta
gttatggtaggagaaaaaaaggcgtatatcatggcattgcgtactccaggtaatgaccgt
aagactgagttagcagctaaaattaggtacgaactaggtcttaaagaagttgaaaatact
tcaaatgtaaatgcggaacaagagaaaactaaaactgaagttaaagaagaaaatgttgag
ccagaagattatattttgactcctgagctaatttattctggacagattgatccaatgatt
ggaatggaagatattaaattggaagaaaaaagatag

DBGET integrated database retrieval system