KEGG   Lactobacillus johnsonii DPC 6026: LJP_1165cHelp
Entry
LJP_1165c         CDS       T01960                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ljh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1259368..1261743)
Genome map
AA seq 791 aa AA seqDB search
MAETSFTGRINGIVFENNQDLFKIIDVDLISKLPDYDRDNIRVTGNFGDIQIGSTYKFTG
NIVVHEKFGKQFRIRSYEPVLPHEEGSLAKYLSSDKFPGIGKRAAEKIIDSLGTNALDLI
KSNQTEIDNLDLTQKQKDSLLSGINQMDSFSEIVIKLARYGINKKVAGNIYKVYHGDSLK
KLEEDPYQALGEVRGFGFKTADNMGHALGIELNDPRRVRGALLSILQTALNTLGDTYVAL
DELLTQAYDLVQSTSYDELANSVNELQRQGKVVVSGDKAALQTIFQTELDIATELKHVVN
NQVEKEEFDDSDIEKAIKHVEETLEIEYDDTQKNAIKNALNNPISILTGGPGTGKTTIIN
GILMCLKELAEIPSAALYSDDPPFLLAAPTGRAAKRMSEVTDISAKTIHRLLGLGIGENE
ATDVNELNGEILIIDEMSMVDMFLFKQLLSGINSTKRIVFVGDKDQLPSVGAGNVFSDLI
SSGAFPTTKLQVIHRQGEDSSIIKLAHAINDEEAEETIFNKTKNYSFIPCQPSLVGDAID
QIVNLAIKRGFKKDDVQVLGAMYNGQGGITHLNDILQDVMNPLSAKTKVIEAHNESFRIG
DRILQLQNNPEKDIYNGQIGKIIGLNPDDKAKILIADFDGREIEFGIKDLNDITRAYAIT
IHKSQGSEFPLVILNLTMQNYMMLRRNLLYTAITRAEKNLVMVGEKKAYIMALRTPGNDR
KTELAAKIRYELGLKEVENTSNVNAEQEKTKTEVKEENVEPEDYILTPELIYSGQIDPMI
GMEDIKLEEKR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactagttttactggacgaataaatggaattgtttttgaaaacaatcaagat
cttttcaagattattgatgtagatttaatcagtaaattacctgattacgatcgtgataat
atccgagtaactggaaattttggggatatccaaattggatcaacttataaatttaccggt
aatattgtcgtgcacgaaaaatttggtaaacaatttcgtataaggtcttatgaaccagtt
ttgcctcatgaagagggtagtttagctaaataccttagttctgataagtttcctggaatc
ggtaagagggctgctgaaaagatcattgatagtttaggaacaaatgcgttagatttgatt
aagtcaaatcaaactgaaattgacaatcttgatttgacccaaaagcaaaaggatagctta
ttatctggaattaatcagatggattctttttcagagattgtgattaagctggctagatat
gggattaataaaaaagtagccggtaatatttataaagtgtatcatggtgattccttgaag
aaactagaggaagatccttatcaagcccttggtgaagttcgcggctttgggtttaaaact
gcggataatatgggacacgcgctcggaatagaactaaatgatcctagaagagttagggga
gcacttctaagtattttacagactgctcttaataccttgggagatacttatgttgcactt
gatgaattattaacacaggcttatgatttagttcaatctacctcttatgatgagcttgct
aatagtgttaatgaacttcaaaggcaaggaaaagttgttgtttcaggtgataaggcagct
ttgcagacaatttttcaaactgaacttgatatagccactgaattaaaacatgtagttaat
aatcaagtcgaaaaagaagaatttgatgatagcgatattgaaaaagcaataaagcatgtc
gaagaaacacttgaaattgaatatgatgatactcaaaaaaatgcaattaaaaatgcgtta
aataatccaatttcaattcttactggtggtcctggtactggtaaaacgacaattatcaat
ggaattttaatgtgcttaaaggaacttgcggaaattccaagtgcagctttgtatagcgat
gatccaccatttttacttgctgcaccaacgggtcgagctgccaagcgaatgagtgaggtt
acagatatttcagcgaaaaccattcaccgtttattagggttaggcatcggtgaaaatgaa
gcgactgatgtaaacgaattaaacggtgagatcttaattattgacgaaatgtcgatggtt
gatatgtttctctttaaacagcttttatccggtattaattcaacaaagaggatagttttt
gttggggacaaagaccagcttccttcagttggagcagggaatgtttttagtgatttaata
agttcaggggcatttccaactacaaagttgcaagtaattcatagacagggagaagactcc
tcaattattaagttggcccatgcaattaatgatgaagaagcagaagagactatttttaat
aaaactaaaaattactcctttattccatgtcaaccaagcttggtgggggatgcaatcgat
caaatcgtaaatttggctattaaacgtggtttcaaaaaggatgatgttcaagttctggga
gcaatgtacaatggtcaaggtggaattactcacttgaatgatattttgcaggatgtgatg
aatccactgtcggcaaaaactaaagtaattgaagctcacaatgaaagttttagaatcggg
gaccgaatcctacaattacaaaataatccagaaaaagatatttataatggtcaaattggt
aaaattattggccttaatcctgatgataaagccaaaatattaattgctgattttgacggt
cgtgaaatagaatttggtattaaagacttaaatgatattacccgtgcgtatgccattact
atccataagtcccaaggatcagaatttccgttagtaattttaaatcttacgatgcaaaat
tatatgatgttgaggcggaatttgttatataccgccattactcgtgccgaaaaaaactta
gttatggtaggagaaaaaaaggcgtatatcatggcattgcgtactccaggtaatgaccgt
aagactgagttagcagctaaaattaggtacgaactaggtcttaaagaagttgaaaatact
tcaaatgtaaatgcggaacaagagaaaactaaaactgaagttaaagaagaaaatgttgag
ccagaagattatattttgactcctgagctaatttattctggacagattgatccaatgatt
ggaatggaagatattaaattggaagaaaaaagatag

DBGET integrated database retrieval system