KEGG   Lactobacillus johnsonii DPC 6026: LJP_1226Help
Entry
LJP_1226          CDS       T01960                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ljh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ljh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319188..1320540
Genome map
AA seq 450 aa AA seqDB search
MNLKSGIAKVAGKSSYWFLHNVLKGGTSFPGKFAMKIDPEVLNSLAKGYETIIVTGTNGK
TMTTALIVEALKKKYGDILTNPSGSNMQQGIVTAFLAHKNKRAKKKIAVLEVDEANVKMV
TKLLHPSVFVLTNIFRDQMDRYGEIYTTYQKIVDGIKLAPDATIIANGDASIFSSVELPN
KKVFYGFKLPEDKPENDFKAPVNTDGVLCPKCDHILHYHERIYANLGDYFCPNCGYHRPE
LTYSVNQIIDQTPNSLKFKMGEKEYSIGIGGTYNIYNALAAYSVAREFGLSEEEVAQSFA
ENKRIFGRQELINYADKEIDLILVKNPVGLDEVLHMLNTEKDNYSLVTLLNANHADGIDT
SWIWDADYEGLNKDQIKKVIVGGKRWHDMGFRLEVSGFEPGLMTTATNNEALLDEISKLP
TKKVYILATYTAMLSLRKTMGEKKIIKAGM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaatcaggcatcgctaaggtagctggtaaatcatcttactggtttcttcat
aacgtattaaagggcgggacgagttttcctggaaaatttgccatgaaaattgatcctgaa
gtattaaattcattagcaaaaggctatgagacaatcattgttactggaactaatggtaaa
acaatgacaaccgctttaatcgtggaagcattaaagaagaaatatggtgatattttaact
aatccatcaggctcaaatatgcaacaaggaattgttacagcatttttagctcacaagaat
aaaagagcaaaaaagaaaattgctgtactagaagtagatgaagcaaatgtaaaaatggtg
accaaattacttcatccaagcgtatttgttttaactaatattttccgtgatcagatggat
agatacggtgaaatttatactacctaccaaaagattgtcgacggaattaaactagctccc
gatgcaactattatcgctaacggagatgcaagtattttttcatccgtggaattacctaat
aaaaaagtattctatggcttcaaacttccagaggacaagcctgaaaatgacttcaaggct
cccgtaaatactgatggtgttttatgtcctaagtgcgatcatatcttgcattatcacgaa
cgtatttatgcaaacttaggagactatttctgtcctaattgtggctaccatcgtccagaa
ttaacctatagtgtaaatcaaattattgatcaaactccaaatagcttaaaattcaaaatg
ggtgaaaaagagtacagcattggtatcggtggtacctataatatctataatgctctagct
gcttattctgtagcgcgtgaatttggtttaagtgaagaagaagtagcccaaagttttgct
gaaaacaaacgaatttttggtcgccaagaattgattaattatgcagataaggaaatagat
ctcatcttagttaaaaatccagttgggcttgatgaggttctccatatgttaaatactgaa
aaagataactattctttagttactcttttaaatgcaaatcacgcagacggaatcgataca
tcctggatctgggatgcagactatgaaggtttaaacaaagatcaaatcaaaaaagtaata
gtcggtggaaaacgttggcatgatatgggattcagactggaagtttcaggttttgagccg
gggttaatgacaactgctactaataacgaagctttgctagatgaaatttcaaaattacca
actaagaaagtttatattttagccacttatactgctatgctttcacttcgtaaaacaatg
ggtgaaaagaaaattattaaagcaggtatgtaa

DBGET integrated database retrieval system