KEGG   Lactobacillus johnsonii DPC 6026: LJP_1278cHelp
Entry
LJP_1278c         CDS       T01960                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJP_1278c
   01230 Biosynthesis of amino acids
    LJP_1278c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_1278c
   00051 Fructose and mannose metabolism
    LJP_1278c
   00562 Inositol phosphate metabolism
    LJP_1278c
Enzymes [BR:ljh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LJP_1278c
Exosome [BR:ljh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LJP_1278c
  Exosomal proteins of bladder cancer cells
   LJP_1278c
  Exosomal proteins of melanoma cells
   LJP_1278c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1369521..1370276)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTIEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKTAEGSNLH
TGAENAYFEVEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQDEWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacacatgaaccctgaacaaaccatt
gaatttgttaatgcagttaagggtaagttgccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttatgttttaaagaagactgctgaaggctcaaacttacat
actggtgcagaaaatgcatactttgaagttgaaggtgcctttactggtgaaacttcacct
aaagttttgaatgaaatgggtattgactactgtattattggtcactcagaacgtcgtggt
tacttccacgaaactgatgaagacattaacaagaaagctaaggctttatttgctaatggc
gtaactccaatcatttgctgtggtgaatctcttgaaactcgtgaagctaacaagcaagat
gaatgggtagtagctcaaattaaagctgctttagatggcttaactgcagaacaagtttct
aaacttgttattgcttacgaaccaatttgggctatcggtactggtaagactgcttctgct
gatcaagctgaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaatgaa
gaaactgctgaaaacgttcgtatccaatacggtggttcagtaaaaccagctaacgtaaaa
gaattaatgtctaagcctgacattgatggtggtttagttggtggtgcttctcttgatcca
gaatcattcttagcattggtaaactaccaagattaa

DBGET integrated database retrieval system