KEGG   Lactobacillus johnsonii DPC 6026: LJP_1278cHelp
Entry
LJP_1278c         CDS       T01960                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ljh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ljh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ljh00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ljh00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1369521..1370276)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTIEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKTAEGSNLH
TGAENAYFEVEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQDEWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacacatgaaccctgaacaaaccatt
gaatttgttaatgcagttaagggtaagttgccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttatgttttaaagaagactgctgaaggctcaaacttacat
actggtgcagaaaatgcatactttgaagttgaaggtgcctttactggtgaaacttcacct
aaagttttgaatgaaatgggtattgactactgtattattggtcactcagaacgtcgtggt
tacttccacgaaactgatgaagacattaacaagaaagctaaggctttatttgctaatggc
gtaactccaatcatttgctgtggtgaatctcttgaaactcgtgaagctaacaagcaagat
gaatgggtagtagctcaaattaaagctgctttagatggcttaactgcagaacaagtttct
aaacttgttattgcttacgaaccaatttgggctatcggtactggtaagactgcttctgct
gatcaagctgaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaatgaa
gaaactgctgaaaacgttcgtatccaatacggtggttcagtaaaaccagctaacgtaaaa
gaattaatgtctaagcctgacattgatggtggtttagttggtggtgcttctcttgatcca
gaatcattcttagcattggtaaactaccaagattaa

DBGET integrated database retrieval system