KEGG   Lactobacillus johnsonii DPC 6026: LJP_1294cHelp
Entry
LJP_1294c         CDS       T01960                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LJP_1294c
Enzymes [BR:ljh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LJP_1294c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1391022..1393028)
Genome map
AA seq 668 aa AA seqDB search
MTKTLSRFLYGGDYNPDQWTEETWPEDIKVFKKADLNSATINIFSWAVLEPREGVYDFSK
LDKIVQELSDANFDIVMGTATAAMPAWMFKKYPDIARVDYQGRRHVFGQRHNFCPNSKNY
QRLDSELVKKLAQHYADNPHIVVWHVNNEYGGNCYCGNCQNAFRDWLRNKYKTLGALNKA
WNMNVWSHTIYDWDEIVVPNELGDAWGPESSEAIVAGLSIDYLRFQSESLQNLFKMEKAV
IKKYDPETPVTTNFHSLPNKMIDYQKWAKDQDIISYDSYPTYDAPAYKPAFLYDLMRSLK
HQPFMLMESAPSQVNWQSYSPLKRPGQMAATELQAVAHGADTVQFFQLKQAVGGSEKFHS
AIIAHSQRTDTRAFRELADLGQKLKEAGPTILGSKTKAKVAIVFDWSNFWSYEYVDGITQ
DLNYVDSILDYYRQFYERNIPTDIIGVDDDFSNYDLVVAPVLYMVKAGLAEKINSYVEKG
GHFVTTYMSGMVDSTDNVYLGGYPGPLKDVTGIWVEESDAMVLGQKVRVKMDDKEYETSL
MCDLIHPNKAKVLASYADEFYAGTAAITENDYGKGKAWYVGTKLGHQGLTQLFNHIVLET
GVESLVCDSHKLEVTKRVTADGKKLYFVLNMSNEERELPNKFADYEDILTGEKAKSSMKG
WDVQVLTK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacattatcacgttttctttatggtggggactacaatcccgatcaatggaca
gaagaaacatggcctgaagacattaaggtctttaaaaaggcagatttaaattcagctaca
attaatattttctcttgggcagttcttgaacctagagaaggagtctatgacttttctaaa
ttagacaagatcgttcaagaattatctgatgcaaactttgatattgtgatgggtacggca
acagccgcaatgccagcctggatgtttaaaaagtatccggatattgcaagagttgattac
caaggcagacgtcacgtctttggtcagcggcacaatttctgtccgaacagcaagaattat
caaagactggatagtgagttagttaaaaaattggcccagcactacgctgacaatccgcat
atcgtagtttggcacgtgaacaatgaatacggtggcaactgctactgtggaaattgtcaa
aacgccttccgtgattggttgagaaacaaatacaagaccttgggtgcgctcaacaaggct
tggaacatgaatgtttggagtcacacgatttatgactgggatgaaattgttgttccaaac
gagttgggggatgcatgggggccagaaagtagcgaagccattgttgctggcctttcaatc
gactacttacgctttcaatccgaaagtttgcaaaacctcttcaagatggaaaaggcagtc
atcaagaagtacgatcctgaaacgcctgtaactactaacttccacagtttgccaaacaag
atgattgactatcaaaagtgggccaaggatcaagatattatttcctatgatagttatcca
acttacgacgcacctgcttataagccagcattcttgtatgacttaatgagaagccttaag
catcaaccatttatgttaatggaatctgcaccttcacaagttaactggcaatcttacagt
ccactaaagcgtccaggtcaaatggccgcaactgaattgcaagctgttgctcacggtgct
gacactgttcagttcttccaattaaagcaagcagtgggtggttccgaaaaattccacagt
gcaattattgctcattcacaaagaaccgatactagagccttccgtgaattggctgatttg
ggtcaaaaattaaaggaggctggtccaacaatcttaggttcaaagactaaagctaaagtc
gcaattgtctttgattggagcaacttctggtcgtacgaatatgttgatggcattactcaa
gatttgaattatgttgactcaattttggactactaccgtcaattctatgaacgcaacatt
ccaaccgatattattggtgttgatgatgactttagtaactatgacttggttgttgcacca
gtgctttacatggttaaagcaggtttagctgaaaagatcaacagctatgttgaaaagggc
ggccacttcgttactacctacatgtcaggtatggttgattcaactgacaatgtttacctt
ggcggctatcctggtccattgaaagatgtcaccggcatctgggttgaagaaagcgacgca
atggttctaggtcaaaaagttagagttaagatggatgacaaggaatacgaaaccagctta
atgtgtgatttgattcatccaaataaggccaaagttttggcaagctacgctgatgagttt
tacgctggcactgctgcgattactgaaaatgattatggcaaaggcaaggcttggtacgtt
ggaaccaagttaggtcaccaaggtttgacacaattattcaaccacattgtgcttgaaact
ggagttgaatcattagtttgcgacagccataagcttgaagtaactaagcgtgtcacagca
gatggcaagaaactttacttcgtgcttaacatgagcaatgaagaaagagaactgccaaat
aaatttgcggattatgaagacatcttaactggtgaaaaagctaagagttcaatgaaagga
tgggatgtccaagtcttaaccaagtaa

DBGET integrated database retrieval system