KEGG   Lactobacillus johnsonii DPC 6026: LJP_1392cHelp
Entry
LJP_1392c         CDS       T01960                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ljh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1492640..1493470)
Genome map
AA seq 276 aa AA seqDB search
MPEMPEVETVKRTLTPLVKGKTIAKIIIWYPKIIVNNPDEFVEKLTNKKILKIDRYGKYL
LFRFSDDLTMVSHLRMEGKYHLVTPDHPKGKHEHVEFVFTDGTALRYADVRKFGRMHLVE
TGTEKQTTGIRHLGPEPNTEEFSVEYFINALSRKKKNIKNTLLDQTVVCGLGNIYVDEVL
WQSKIHPLSSAKSIPADKIVDLYHNINHTITVATKERGTTVHTYLDANGDIGGYQNMLQV
YGHAGEECNNCGTILEKIKVNGRGTTFCPHCQVLYK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatgccagaagtagagacagttaaaagaacgctaactcctttagttaaagga
aaaacaattgctaaaattattatttggtatccaaagattatagttaataatcctgacgaa
ttcgttgaaaaattaacgaataaaaaaattttgaaaattgatcgttatggcaagtattta
ctatttagatttagcgatgacctgactatggtttcccatttacgaatggaaggaaaatat
catttagtgactcctgatcatcctaaaggaaagcacgagcatgtggaatttgtttttact
gatggaactgctctgcgctatgctgacgtacgtaaattcggaagaatgcatttagtagaa
actggaacagagaagcagacgaccggaattcggcaccttggccctgaaccaaacactgaa
gagtttagtgtagaatactttattaatgctctaagtcgaaagaagaagaatattaagaat
actcttttagatcaaaccgtagtttgtggtttaggaaatatttatgttgatgaagtattg
tggcagagtaaaattcatcccttaagtagtgcgaagtcaattcctgctgacaagatagta
gatttatatcacaatataaatcatacgattactgttgcaactaaagagcgcggtactacg
gtacatacttatttggatgctaatggtgatataggtggttaccaaaatatgctccaggtt
tacggtcatgcgggtgaagagtgtaataattgtggcactattctagagaaaattaaagta
aatggacgcggaactactttctgtccgcattgtcaggtgctatacaaatga

DBGET integrated database retrieval system