KEGG   Lactobacillus johnsonii DPC 6026: LJP_1608cHelp
Entry
LJP_1608c         CDS       T01960                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LJP_1608c
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LJP_1608c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1753404..1753961)
Genome map
AA seq 185 aa AA seqDB search
MQRIIIIAGPSGVGKTTVSKYLTEKYNIPRVVTHTTRPVRQGEIPGKSYYFETDESFKKL
HFFEHVKYGEYQYGSSKEALEKAWAKNDLVSLIVETDGVKSYLEKLGKQAYFIYLTVSDF
SVLKKRLLGRGDKASEIDKRLNSFEFKRDLHLSDELAKKAHVLNNDNWEKTAKELDKIVK
KLENK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagaattatcataattgcgggaccaagtggagtaggaaagacaacagtctcaaaa
tacttaacggaaaaatataatattccgcgtgtagtaacacatactactaggccagttaga
caaggagaaattccggggaagtcatattattttgaaactgatgagagttttaaaaaactt
catttctttgaacatgtaaaatatggggaatatcaatatggatccagtaaagaagcttta
gaaaaagcctgggcaaagaatgacttggtttctttaattgttgagactgacggagttaag
tcctatttagaaaaattaggaaagcaagcatattttatttatttaactgtttcagatttt
tcagttctaaaaaagcgattattaggacgcggagataaagctagtgaaattgataaaaga
ttaaatagttttgaatttaagcgtgatttacatttgtcagatgaacttgctaaaaaagca
catgtattaaataatgacaactgggaaaagacagctaaagaactcgataagatcgtaaaa
aagctggaaaataaatag

DBGET integrated database retrieval system