KEGG   Lactobacillus johnsonii DPC 6026: LJP_1755cHelp
Entry
LJP_1755c         CDS       T01960                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LJP_1755c
Enzymes [BR:ljh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LJP_1755c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922322..1923083)
Genome map
AA seq 253 aa AA seqDB search
MKFPKGRIPFEFEREDLAKVVKILMERRDTNIVGGNISIRVYDEEGKEYLVMTPTMMSEA
YLGHLNADQILVIDPKTRKIISGTGKLTREINMHEAIYTANSNITCVFHAHADQAMFWAT
TGLNMPNITEATQKLKGIKTLEWHPMCSEDLAQFMKKQIEKLPQEQIRNAFLLNSHGVLF
TNGGNPLTALHGSLADVDTVEWNAKVAYKQTVLQMNGFLDGYYGEGTKIGTWKDVQDGKA
IYNESLAENKNGD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccaaagggcagaattccatttgaatttgaacgtgaggatcttgcaaaagtt
gttaaaattttaatggagagacgagatactaatattgttggtggtaatatttctattcga
gtttatgatgaggaaggaaaagaatacttagtaatgacaccaacaatgatgtcagaagcc
tacttaggtcatttaaatgctgatcaaattttggttattgatcctaaaactaggaaaatc
atctcaggaactggaaagttaacacgtgaaataaatatgcatgaagcaatatacactgct
aattcaaatatcacatgtgtatttcatgcacatgctgatcaagcaatgttttgggcaact
actggattaaacatgccgaatattacagaagctacacaaaaattaaaaggtataaaaact
ttagaatggcatcctatgtgcagtgaagatttggctcaattcatgaaaaaacaaattgaa
aaattaccacaagagcaaataagaaatgcatttctattaaattctcacggagtactattt
actaatggaggaaatccattgactgcactgcatggatcattagctgatgttgatactgta
gaatggaatgctaaagttgcatataagcaaactgttttgcaaatgaatggatttttagat
ggctactatggagaaggcacaaagataggtacttggaaagatgtgcaagatggtaaagcc
atttataatgaatcacttgcagaaaataaaaacggtgattag

DBGET integrated database retrieval system