KEGG   Lactobacillus johnsonii DPC 6026: LJP_1755cHelp
Entry
LJP_1755c         CDS       T01960                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ljh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922322..1923083)
Genome map
AA seq 253 aa AA seqDB search
MKFPKGRIPFEFEREDLAKVVKILMERRDTNIVGGNISIRVYDEEGKEYLVMTPTMMSEA
YLGHLNADQILVIDPKTRKIISGTGKLTREINMHEAIYTANSNITCVFHAHADQAMFWAT
TGLNMPNITEATQKLKGIKTLEWHPMCSEDLAQFMKKQIEKLPQEQIRNAFLLNSHGVLF
TNGGNPLTALHGSLADVDTVEWNAKVAYKQTVLQMNGFLDGYYGEGTKIGTWKDVQDGKA
IYNESLAENKNGD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccaaagggcagaattccatttgaatttgaacgtgaggatcttgcaaaagtt
gttaaaattttaatggagagacgagatactaatattgttggtggtaatatttctattcga
gtttatgatgaggaaggaaaagaatacttagtaatgacaccaacaatgatgtcagaagcc
tacttaggtcatttaaatgctgatcaaattttggttattgatcctaaaactaggaaaatc
atctcaggaactggaaagttaacacgtgaaataaatatgcatgaagcaatatacactgct
aattcaaatatcacatgtgtatttcatgcacatgctgatcaagcaatgttttgggcaact
actggattaaacatgccgaatattacagaagctacacaaaaattaaaaggtataaaaact
ttagaatggcatcctatgtgcagtgaagatttggctcaattcatgaaaaaacaaattgaa
aaattaccacaagagcaaataagaaatgcatttctattaaattctcacggagtactattt
actaatggaggaaatccattgactgcactgcatggatcattagctgatgttgatactgta
gaatggaatgctaaagttgcatataagcaaactgttttgcaaatgaatggatttttagat
ggctactatggagaaggcacaaagataggtacttggaaagatgtgcaagatggtaaagcc
atttataatgaatcacttgcagaaaataaaaacggtgattag

DBGET integrated database retrieval system