KEGG   Lactobacillus johnsonii N6.2: T285_06785Help
Entry
T285_06785        CDS       T02941                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00071  Fatty acid degradation
ljn00072  Synthesis and degradation of ketone bodies
ljn00280  Valine, leucine and isoleucine degradation
ljn00310  Lysine degradation
ljn00362  Benzoate degradation
ljn00620  Pyruvate metabolism
ljn00630  Glyoxylate and dicarboxylate metabolism
ljn00640  Propanoate metabolism
ljn00650  Butanoate metabolism
ljn00900  Terpenoid backbone biosynthesis
ljn01100  Metabolic pathways
ljn01110  Biosynthesis of secondary metabolites
ljn01120  Microbial metabolism in diverse environments
ljn01130  Biosynthesis of antibiotics
ljn01200  Carbon metabolism
ljn01212  Fatty acid metabolism
ljn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    T285_06785
   00630 Glyoxylate and dicarboxylate metabolism
    T285_06785
   00640 Propanoate metabolism
    T285_06785
   00650 Butanoate metabolism
    T285_06785
  Lipid metabolism
   00071 Fatty acid degradation
    T285_06785
   00072 Synthesis and degradation of ketone bodies
    T285_06785
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T285_06785
   00310 Lysine degradation
    T285_06785
   00380 Tryptophan metabolism
    T285_06785
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T285_06785
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T285_06785
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    T285_06785
Enzymes [BR:ljn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T285_06785
Exosome [BR:ljn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T285_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF543
Motif
Other DBs
NCBI-ProteinID: AHA97718
UniProt: V5P3Y0
Position
complement(1402533..1403699)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKDKSAVDLGVLALKGLLKKNIVPQDKIDSILVGNVLSA
GLGQNVARQIALKSGLPESVVGTSVDDVCGSSLKALRFAQGQMLLGDSQIAIVGGAESMT
NAPLLLDKSKKHDENPAYQDSLMIDGIGDAYSRKPMGITAENVADKYHITRQDMDEFARD
SHAKAYAAQENDWFEEEYAPIELDGNVLDHDETIRPDSSLEALGQLKPVFKENGRVTAGN
SSPLTDGASMLLLSNQQKLDELNLTPLAYLGAYAEIGCDPAYMGYAPYFAIKKLLTKTNS
TIEDYDLIEINEAFAAQAYAVARDLNIPKEKLNIAGGAISLGHPLGATGTRLVMSAVNSL
RKINGRRAIVSLCIGGGQGIAYEIRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaggatgtttatatagtaggaatgaatcgaattccttttggtaagtatcgtgga
ttttataaggataaaagtgctgttgacctaggagtgttagcacttaagggattattgaaa
aagaatattgttccacaagataaaatagatagcattttggtgggaaatgtattaagtgct
gggctaggtcaaaatgtcgctcgacaaatagctttaaaatcaggtttacctgaatctgta
gtgggtactagcgtagacgacgtttgtggttcaagtttaaaggcattacggtttgctcaa
ggtcaaatgctcctaggagattctcaaattgcaattgtaggtggggcagaaagtatgaca
aatgcaccacttttacttgataaaagtaaaaagcatgatgaaaatccagcatatcaagat
agcttaatgatagatggaattggggatgcttattcgagaaagccgatgggaattacagct
gagaatgtagctgataaataccatattacgcgtcaagatatggatgaatttgcacgtgat
tcccatgccaaggcttatgcagctcaggagaacgactggtttgaggaagagtatgcacca
attgaactcgatggtaatgttcttgatcatgatgaaaccattcgaccagattctagttta
gaagcattaggtcaattaaaacctgtatttaaggaaaatggacgagttacggctggtaat
tcttctccgctaactgatggtgcaagtatgttgttgttatctaatcaacaaaaattagat
gaattaaatttaactccattagcatacttgggtgcctatgcagaaattggctgtgatcct
gcttatatgggatacgcaccatattttgctattaaaaaattacttacaaaaactaatagc
acaattgaggattatgatctaattgaaattaatgaggcctttgcagctcaagcatatgct
gtagcccgtgatctaaatattccaaaagaaaaattaaatatcgctggaggagcaattagt
ttaggacatccgcttggtgcaaccggtacgcgcttagtaatgagtgcagtaaacagtttg
cgtaaaattaatggtcgaagagcaattgtatctctatgtattggcggtggccaaggaatc
gcatatgaaattagaagaatcatctaa

DBGET integrated database retrieval system