KEGG   Lactobacillus johnsonii NCC 533: LJ0135Help
Entry
LJ0135            CDS       T00158                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ljo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155381..157330
Genome map
AA seq 649 aa AA seqDB search
MCGICAFFDPELKDKDCAIQGMMDTIKHRGPSSDGKYTNDKVALGFRRLSIIDLRGGSQP
IFNEDKSRAIIFNGEIYNFKPLRKELIDAGHTFTTKADTEVLLHGYEEWGMDGLLKKVRG
MFAFVIWDDNTKTLYGARDFFGIKPMYYSDQNGKLIVGSELKSFLAYPGFKKELNTEAVK
PYLMNQYNDLKETFFKGVYRFPAGHWFEYKDGKMKTHQYWDAKYVENSLSFEETLDKINE
DLKETVDLYRNADVPVGAFLSEGIDSSYLTSLLDPEDVFSVSFDDSTYNEASKAKALSDL
HGWKFFADKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNDVIKVFTAGLKKLPKKSRVRLAHKIKKMPNFPGKVHMYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANGILRDKYKNDLTVNGIYQEDFKKVKNIDEVKQMQYID
LHHFMLNDIEQKADKISMAHSLELRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPEEWAQRPKLGFPTPIKQWLKEPRFYKQVRALFTEDFVDDIFDQKKIVKLLDDNYKG
DGSARRQIWAIYTFLVWYKLFFVDYDETVKKYQHVQPEVAELIESGRLV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttgtgcgttttttgatcctgaattaaaggataaagactgtgctattcaa
ggaatgatggatacaattaaacaccgtggtccatcttccgatggaaaatatactaatgat
aaggtggctttaggttttagacgtttgtcaattattgaccttcgtggtggaagtcaacca
atttttaatgaagataaaagtagagcaattatttttaatggggaaatttataattttaaa
ccattaagaaaagaattaattgatgcaggtcatacctttactactaaggctgatactgaa
gttttacttcacggctatgaagaatggggaatggatggcttattgaagaaagttcgtggt
atgtttgcttttgtaatttgggatgacaataccaagactttatatggtgctcgtgacttc
ttcggaattaagccaatgtactactcagaccaaaatggtaagttaattgttggtagtgaa
ttgaagagcttcttagcttacccaggctttaaaaaggaattaaatactgaagcagttaag
ccatacttaatgaaccaatataatgacttaaaggaaactttctttaaaggtgtttaccgc
ttcccagcaggtcactggttcgaatataaagatggcaaaatgaagactcatcaatactgg
gatgctaagtatgttgaaaatagcttaagttttgaagaaaccttagacaaaatcaatgaa
gacttaaaagaaactgttgatttatacagaaatgcggacgtaccagttggtgcattcttg
tctgaaggtattgattcttcttacttaactagtttacttgatcctgaagatgtcttctca
gtttcttttgatgattctacatataatgaagcatcaaaagctaaggcactttctgactta
cacggctggaaattctttgcagataaagttgatgcagatgaagcaatgcgcgacttccca
gaaatgcaatatcacatggacgaaccagatgctaacccatctattattccattatggtac
ttgtgtaaattagctagaaagcatgttactgttgcactttctggtgaaggtgctgatgaa
ttatttgcaggctacgttaactatggaatgcatacccataatgatgtaattaaggtcttt
actgctggccttaagaaattacctaagaaaagtcgtgttcgtttagctcataagattaag
aagatgcctaacttcccaggtaaagtacatatgtacactaacttggcagagccaagtgaa
ttttatgttggacaatctgtcatttatgatatggactatccaactatctttacttctaaa
gatgctaatggtattttgcgtgataaatacaagaatgatctgacagttaacggtatttat
caagaagactttaagaaagttaaaaatattgatgaagttaagcaaatgcaatatattgat
cttcaccactttatgcttaatgatattgagcaaaaagcagataagatctcaatggctcac
tctctagaattacgtgtgccatatcttgataagaagattgcagaacttgctaactcaatt
ccaactaaatatttagttaaccggcacgatactaaatatgctcttcgtaaagcatctgag
aaggtcttaccagaagaatgggctcaaagacctaagcttggtttcccaactccaattaag
caatggcttaaggaaccaagattttacaaacaagttagagcattgtttactgaagacttt
gtagatgacatttttgaccaaaagaagattgttaaattgcttgatgataactacaagggc
gatggttcagctcgtcgtcaaatttgggctatttacactttcttagtttggtataaatta
ttctttgttgattatgatgaaactgttaagaagtatcaacatgttcaaccagaagtagca
gaattaatcgaaagtggcagacttgtttaa

DBGET integrated database retrieval system