KEGG   Lactobacillus johnsonii NCC 533: LJ0164Help
Entry
LJ0164            CDS       T00158                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ0164 (gpmA)
   01230 Biosynthesis of amino acids
    LJ0164 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0164 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LJ0164 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJ0164 (gpmA)
Enzymes [BR:ljo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJ0164 (gpmA)
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJ0164 (gpmA)
  Exosomal proteins of melanoma cells
   LJ0164 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196136..196828
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattcctgaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggat
actgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggcagaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system