KEGG   Lactobacillus johnsonii NCC 533: LJ0195Help
Entry
LJ0195            CDS       T00158                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ0195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0195
   00052 Galactose metabolism
    LJ0195
   00500 Starch and sucrose metabolism
    LJ0195
   00520 Amino sugar and nucleotide sugar metabolism
    LJ0195
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LJ0195
   00524 Butirosin and neomycin biosynthesis
    LJ0195
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LJ0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(227182..228042)
Genome map
AA seq 286 aa AA seqDB search
MNLIAIDIGGTTIKIATWINQKLKMIFTIDTPDNLDTFYEELTDAVNEIKADHKIDGVAI
SSPGAVNKATGVIEGASALPYIHNFKIVPELEKRFGLPVSIENDANCAALAEIADGAAKG
CSSMAFLVIGTGVGGSIIINNQIWHGAHLYGGEFGFMIIDGKQLSELASPVTMAKRYNKK
TGKDFDGKTVFELADTDDPVAQEERGKLLHALAVAIFNIQHSFDPEKIIIGGGISQNPEL
VPLLDDEIAKLRNKMDIETVKPILDICTLKNEANLRGAVADFEKEH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaatcgcaattgatattggcggcacaactattaaaatcgctacctggataaat
caaaaattaaaaatgatatttacgattgatacaccagataatttagatactttttatgag
gaattgactgatgcagttaatgaaataaaagccgatcataaaattgatggtgtagcaatt
tcttctcctggtgctgttaataaagctaccggagtaattgagggagcaagtgccctacct
tatattcacaactttaaaatcgtacctgaattagaaaaaagatttggtttgccagtaagt
atcgaaaatgatgcaaactgcgcagctcttgccgaaatcgctgacggagcagctaaagga
tgcagtagtatggcatttttagttattggtaccggcgttgggggaagtatcattattaac
aatcaaatctggcatggtgcacatctctatggcggtgaatttggttttatgattattgat
ggtaagcagttaagtgagctagcttcacctgttaccatggccaagcgctacaataaaaaa
actggaaaagattttgatggtaagactgtttttgaacttgctgacactgatgacccagtt
gctcaagaagaacggggaaagctcctccatgctcttgctgtagcaatttttaatattcaa
cacagttttgatcctgaaaaaattattattggtggtggaatttcacaaaatccagaatta
gttcccctactcgacgatgaaattgctaaattaagaaataagatggatatcgagaccgtg
aaaccaattttggatatatgtacattaaaaaatgaagcaaatttgcgtggagcggttgca
gattttgaaaaagagcattaa

DBGET integrated database retrieval system