KEGG   Lactobacillus johnsonii NCC 533: LJ0225Help
Entry
LJ0225            CDS       T00158                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ljo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ljo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259714..260979
Genome map
AA seq 421 aa AA seqDB search
MKQMIIHGGKPLKGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVDNLMDLLSEM
DVKCDFHETTLRINPDNIKRSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIKGFEALGATVENKNDQIIITAPKTGLRGAKIHLKMPSVGATMNIIMASVMAKG
QTIIENAAKEPEIIDLATFLNNMGAVIRGAGTEVIRIEGVEELKAQTPHTIIPDRIEAGT
YVALAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDADEDSLYVYPAGDLKMIQVRTDV
YPGFATDLQQPITPLLLTAKSGEGVVIDQIYPKRVGHIPELQKMGANIQVEDNIILVHPT
HHLHGAHVSAGEIRAGACLMLAGLMADGETIISNAGNILRGYDRIEQKLRQLGAEVSVID
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatgattattcatggtggaaagcccctgaagggcgacgtatggatcggcggt
gctaagaattccactgtagcattgattccagcgtcaatactttcgcggactcctgttacc
ctagaaggggttccgcgaattgctgatgtagataatttgatggatctacttagtgaaatg
gatgtaaagtgtgattttcatgaaactactttacgaataaatccggataacattaagcgt
agtccccttccagcaggaaagattaagagcttgagagcttcttactactttatgggtgca
ttattaggtcgctttggtaaagctgtggtgggctttccaggcggagatgatattggccct
cgtcctattgatcagcatattaaaggctttgaagcattaggtgcaactgttgagaataaa
aacgatcaaattatcattacagctcctaaaactgggcttcgtggtgcaaaaattcattta
aagatgccttctgtaggcgcaacgatgaatataattatggctagtgtaatggcaaagggc
caaactattattgaaaatgctgctaaggaaccggaaattattgatttagctacatttttg
aataatatgggcgccgttattcgtggtgcaggtactgaagtgattcgaattgaaggagta
gaggaattaaaagcacaaactcctcatactattattcctgatcgaattgaggctggaaca
tatgtagctctagctgcttgcatcggaaatggtattagaattcataatattatcgaagaa
cacctagattcttacttggctaaagtagaagaaatgggtgtagtaattgatgctgatgaa
gattcactttatgtttatccagcaggtgacttgaaaatgattcaagttagaactgatgta
tatcctggatttgcgactgatttacagcagccaattactccacttcttctaacagctaag
agcggtgaaggcgtagtaattgatcaaatatatcctaagcgtgttggtcatattcctgaa
cttcagaagatgggtgcaaatattcaggtagaagataatattatcttagttcatccaact
catcatttgcatggagcacatgttagtgctggtgaaattagagcaggcgcttgtttgatg
cttgctggcttaatggcagatggtgaaactatcatttcaaatgcaggaaacattttgcgt
ggctatgatagaattgaacaaaagttgcgtcaactaggtgcagaggtatctgtgattgat
gtttaa

DBGET integrated database retrieval system