KEGG   Lactobacillus johnsonii NCC 533: LJ0261Help
Entry
LJ0261            CDS       T00158                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LJ0261
  Lipid metabolism
   00561 Glycerolipid metabolism
    LJ0261
   00600 Sphingolipid metabolism
    LJ0261
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LJ0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291959..294157
Genome map
AA seq 732 aa AA seqDB search
MNQLINFDKKNKVFHLHNNQISYLLAVEDGNTLAHVYFGKTIKQYHGQLRYPRVDRGLSG
NLPGSLDRTFSRDSLPKEYSTAGEMDYHTPAAVVRQKDGSNALFLTYHGYKIVAGKPDLV
GLPHSFVENSDEAETLIVNLTDEKSKIKFELAYTIYRDYPVITRSVKVVNNGEDTVNIEK
VASMQIDFVDRDFESITLPGAHAHERRVERSKINQGIHVYSSHRGTSSHQMNPFMALVDP
DTTEFAGDAYGFVFVYSGNHKFEVEKDQFAQTHVNIGINNFNFNWELKPKDSFQTPEVLM
TYSNQGLNKMSQAFHSLIHDRIIRSKYKDQVRPILVNNWEATYFDFDEEKLKPIVDDAKE
MGIEMFVLDDGWFGHRDDDNSSLGDWSVFEKKFPHGLDHFANYVHDQGLKFGLWFEPEMI
SMDSNLYREHPDYLMHVPGRTPSPSRNQYVLDLGRKEVRDNIFEQMNKILESGKIDYIKW
DMNRHLSDIYEADLPAARQGETYHRYVLGLYDLLERLVDTYPNLLIEGCSGGGGRFDAGM
AYYNPQIWASDDSDAIDRLSIQYGTSLAYPQSMMTSHVSVSPNEQNGRITPFNTRGIVAM
WGDLGYELDLTKMSKENRQAVKDQVEKYKKIREVTQYGTFYRLKSAQTSNQCAWETVSKD
KNEAVLSVVKVMASAQPYLTKTKMVGLNPEKHYEDQKTHEIYGGDELMNLGIYDSVEHGD
FKAYIHHFKAID
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaactaattaattttgataaaaaaaataaagtttttcatttacataataatcaa
atttcatacttattagcagttgaagatggaaatacacttgctcacgtgtattttggtaaa
acaattaaacaatatcatgggcaattacgctatccgcgagtagaccgaggcctttctggt
aatttgccgggctcactagatagaactttttcacgtgattctttaccaaaagaatacagt
acagctggtgaaatggattaccatactccagcagcagtagttcgccaaaaggatggatct
aacgccttatttttaacttaccatggttataaaattgtggccggaaagcccgatttagta
ggattacctcattcttttgttgaaaatagtgatgaggcagaaactttaatagtcaattta
accgatgaaaagagcaaaattaaatttgaattagcttatacaatttatcgtgattatcca
gtaattacccgttcagtaaaagttgttaataatggtgaagatacagttaatattgaaaaa
gttgcttcaatgcaaattgattttgttgatcgtgactttgaatcaattactttacctggt
gcgcatgcacatgaaagacgagtagaacgtagcaaaatcaatcaaggtattcatgtttat
tcaagccatcgcggcacttctagtcatcaaatgaatccatttatggcattagttgatcct
gatacaaccgaatttgctggggatgcttacggatttgtattcgtttactctggtaatcac
aagtttgaagtggaaaaagaccaatttgctcaaactcacgtcaatattggcattaataat
tttaactttaattgggagttgaagccaaaagatagcttccaaacgccagaagtcttaatg
acttattctaatcaaggtctaaataagatgagccaagcatttcatagcttgattcatgat
cggattattcgtagtaagtacaaagatcaagttcggccaattttagtaaataattgggaa
gcaacttacttcgactttgatgaagaaaaattaaaaccaattgtagatgatgccaaagaa
atgggtattgaaatgtttgtccttgatgatggttggtttggtcatcgtgatgatgataat
tcttcactaggagattggagtgtttttgaaaagaaattcccgcatggattagatcatttt
gctaattatgtccatgaccaagggttaaaatttggcctttggtttgagccagaaatgatc
tcaatggattcaaacttatatagagagcatcctgactatttaatgcatgttccaggaaga
actccaagtccatctcgtaatcaatatgttctggatttaggtagaaaagaagttcgtgac
aacatatttgagcaaatgaataagattcttgaatcaggtaagattgattacattaaatgg
gatatgaatcgtcacttgtcagatatttatgaagcagatttgccagctgcaagacaggga
gaaacttaccatcgttatgtcttaggactttatgatctgcttgaaaggctagttgatact
tatccaaacctattaattgaaggctgttctggtggtggtgggcgcttcgatgctggtatg
gcatattacaatccacagatttgggctagcgatgatagtgatgcaattgatagattaagt
attcaatatggcactagtttagcttatccacaatcaatgatgacttctcatgtttcagtt
agtccaaatgagcaaaatggacgaattacaccattcaatacacgtggaattgtggcaatg
tggggtgatttaggttatgaactcgatttaactaagatgagcaaagaaaatcgtcaagca
gttaaagatcaggtagaaaaatataaaaagattagagaagttacccaatatgggactttt
taccgcttaaagtctgctcaaactagtaatcaatgtgcttgggaaacggtctcaaaagat
aaaaatgaagctgttttgtcagtagttaaggtaatggcaagtgctcaaccgtatttaact
aagactaaaatggttggacttaatccagaaaagcactatgaagatcaaaagacccatgaa
atatatggtggagatgaactgatgaacttaggaatttatgattcagttgaacacggtgat
ttcaaggcttatattcatcactttaaggcaatagattag

DBGET integrated database retrieval system