KEGG   Lactobacillus johnsonii NCC 533: LJ0262Help
Entry
LJ0262            CDS       T00158                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LJ0262
Enzymes [BR:ljo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LJ0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294169..295611
Genome map
AA seq 480 aa AA seqDB search
MTISNKVMLITYPDSLGKNIKDLDDVLHTDLKGAVGGVHLLPFFPSTGDRGFAPTDYSMV
DPQFGDWSDVEKLGEDYYLMFDFMINHISRQSKYYKDFQKNKDQSPYADLFLSWDKFWPK
NRPTQKDIDLIYKRKDRAPYQEITFADGSKEKLWNTFGEEQIDLDVRKDVTKQFIKQTLN
NLIDHGSDIIRLDAFAYAIKKLDTNDFFVEPEIWDLLKEVQDDISAKGALILPEIHEHYS
MPFKIARHGYFIYDFALPMVVLYSLYSGKSQRLASWLKKSPMKQFTTLDTHDGIGVVDAR
DILTPNEIGYTSNELYKVGANVKKKYSSAEYHNLDIYQINSTFYSALGDDDKKYFMARLL
QVFAPGIPQVYYVGMLAGKNDIELLEKTKEGRNINRHYYSREEIHEEVQRPVVSSLINLL
RFRNNEAAFDLNGSIEVTTPTENEIHIIRLNQDKTRKAELRANLETLAYKVLVNGREMAF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttcaaataaagtaatgctcataacctatccagatagtttaggtaaaaatatt
aaagatttagatgacgtactgcacacagacttaaaaggtgctgttggaggagttcatttg
ttaccattctttccctcaactggtgaccgcggatttgctccaacagattattcaatggtt
gatcctcaatttggagattggtctgatgtcgaaaagttaggcgaagactactaccttatg
tttgattttatgatcaatcatatttctcgtcagtctaagtactataaggattttcaaaag
aataaagatcaaagtccttatgctgaccttttcctcagttgggataagttctggcctaag
aatcgaccaacgcaaaaagatattgaccttatttacaagagaaaagatcgtgctccatat
caggaaattacttttgcggatggaagtaaagaaaaactctggaatacttttggtgaggag
caaatagatcttgatgttcgaaaagatgtaactaaacagtttattaagcagactttaaat
aatttgattgatcatggcagtgacatcattcgactagatgcgtttgcttatgctattaag
aagttagatactaatgactttttcgtagaaccagaaatttgggatctattgaaagaagta
caagatgatatttcagctaaaggcgcgctaattttgcctgaaattcatgaacactattca
atgccatttaagattgcaagacatggttactttatttatgattttgccttaccaatggtg
gtgctttattcactatatagcggtaaaagtcagcgtcttgcttcatggctaaaaaagagt
ccaatgaagcagtttacgacattagatactcatgatggaattggtgtagtagatgctcgt
gatatcttaactccgaatgagataggatacacaagcaatgaattgtataaggtcggcgct
aatgttaaaaagaaatactcaagtgcggaatatcataacctcgatatttatcaaataaac
tctactttctactctgcacttggtgatgatgataaaaaatactttatggctcgactttta
caagtatttgcacctggaattccccaagtctattatgttggaatgcttgctggtaaaaat
gatattgaacttcttgaaaagacaaaagaaggtcgaaatattaatcgtcattattatagt
cgtgaagaaattcatgaagaagttcaacgtcctgttgttagttctttaattaacttatta
agatttagaaataatgaagcggcatttgatttgaatggaagtattgaagttactactcct
actgaaaatgaaattcatattatccgtttgaatcaggacaaaacacgaaaagcagaatta
cgtgcaaacttagaaaccttagcttataaagtgttagtgaatgggcgagagatggctttt
taa

DBGET integrated database retrieval system