KEGG   Lactobacillus johnsonii NCC 533: LJ0425Help
Entry
LJ0425            CDS       T00158                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJ0425 (recR)
DNA repair and recombination proteins [BR:ljo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LJ0425 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469941..470540
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDNYMKLPGIGEKTATRLAFYTMDMPEQDVEDFSKSLMQVKENLHSCSIC
GNITESDPCEICRDSNRDRSTIMVVEQPKDVMAFEEMGEYNGLYHVLHGVLSPMDGVGPE
EINIKSLITRLQKQDEVKEVILALNSSPEGEATAMYLAKLIKPAGLKVTRLAAGLAVGSD
IEYANSITLKRAVQGRTDL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccattaccaattgcccgtttaattgataattacatgaagctgcctggtatt
ggtgaaaaaacagcaactcgcttagccttttacacaatggacatgccagaacaggacgtg
gaagacttttctaagtcattaatgcaggtaaaagaaaatcttcattcttgttctatttgt
ggaaatattactgaaagtgatccatgtgaaatttgccgcgattcaaaccgtgaccgctca
acgataatggtagttgagcaaccaaaagatgtcatggcttttgaggaaatgggcgaatat
aatggcttgtaccatgtcttacatggagtcttgtccccaatggatggagtaggcccagaa
gaaattaacattaaaagtttaattaccagacttcaaaaacaagatgaagttaaagaagtt
attcttgccctaaactccagcccagaaggtgaagcaactgctatgtatctggccaagctg
attaagccagctggcttaaaggtaacgcgtcttgctgctggtttagccgtaggtagcgat
attgaatacgccaactcaattactttgaagcgcgctgttcaagggagaacagatctatga

DBGET integrated database retrieval system