KEGG   Lactobacillus johnsonii NCC 533: LJ0467Help
Entry
LJ0467            CDS       T00158                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJ0467 (ruvA)
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LJ0467 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512087..512665
Genome map
AA seq 192 aa AA seqDB search
MFEYLKGIVTKIDPAYIVLDVNGVGYKILCPTPYSYDENQPATIYVEQVVRDTGITLYGF
LSLEDKELFLKLLSVSGIGPKSAVAIMAAEDTDSLASAIQNGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVKKSTAAADLTPSLQDALLALVALGYTQKEVDRITPKLAKLPENTADG
YVKEALALLLKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctcaagggaatagtaacaaaaattgatccagcttatatcgttctagat
gtaaacggagttggctataagattctttgtcccactccttatagttatgatgaaaatcaa
cctgcaacaatttacgttgagcaagttgtaagagataccggaattactttgtatggtttt
ttgtctttagaagataaagaattatttttaaaattattaagtgtttcaggaattggacct
aagtctgctgtggcaattatggctgctgaagatactgattctttggctagtgcaattcaa
aatggtgaagtaaaatacctgactcgtttcccgggagtaggaaaaaagactgcttcccag
attgtcttagacttgaagggaaaactaggcgactatgtaaaaaaatcaactgctgctgcc
gatcttactccaagtctgcaagatgctttacttgccttagtagcacttggttatacccaa
aaagaagttgatcgaattacgccaaaattagcaaaattacctgaaaacactgctgatggt
tatgttaaggaagcattggctttactacttaagaaataa

DBGET integrated database retrieval system