KEGG   Lactobacillus johnsonii NCC 533: LJ0544Help
Entry
LJ0544            CDS       T00158                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ljo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835953..1837431)
Genome map
AA seq 492 aa AA seqDB search
MKYYHVPEGFKWGVATAANQIEGAWNEDGKGISIADCERYDPEKARAGYKSANSMTSSEI
KRAMADKDSKRWGKRHGVDFYHQYPEDIKKLAATGINTFRTSIAWSRIFPNGDDIKPNEK
GLEFYDKLFDELHRYNIEPIVTLSHYEMPLNLVLNYDAWYDLRVREFFIKFAKIVIDRFH
GKVKYWIPINEIDSILRHPFSSAGLIRDRFLNENFEKVIYQAMHNQFVAAAAITKYIHET
YSDIQVGSMITSTMIYPYNSDPRNSLKSVQLMRESYNFSDIQIRGKYPLNLVPKLKNLHI
KISKEDLDLISENTADFIAFSYYSSVCTAFDTKGLKVTKANRMEGVYNKYLPTSDWGWQI
DPIGLRIILINLYDRYQKPLFIVENGLGAKDSLTTSGKIHDDYRIDYLRQHIKQMLVSIQ
NDGIELMGYCMWGMTDMVSASTTQISKRYGLIYVDLDDFGDGTYKRYLKDSYFWYQKLLS
FKNKIPKDFLDK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatcacgtgcctgaaggatttaagtggggtgtcgcaacggctgctaatcag
atagaaggagcttggaatgaagatggtaaaggaatttcaattgctgattgcgaacgctat
gatcctgaaaaagcgagagcaggctataagtcagcaaatagtatgacaagttctgaaatt
aaacgtgctatggcagataaagatagtaaacgttggggaaaaaggcatggagtagatttt
tatcatcaatatcctgaggatataaaaaaattagcggctacgggaattaatacttttaga
acttctattgcatggagtagaatttttccaaatggtgatgatattaagcctaatgaaaag
ggactagaattttatgataagttatttgatgagctacatagatataatattgaaccaata
gttactctatctcattatgagatgcccttaaatttagtattaaactacgatgcttggtat
gatttgcgcgttagagagttttttataaagtttgcaaaaattgtgatagatcgttttcac
ggcaaagttaaatattggattccgattaatgaaatagatagtattttgcgtcatccattt
tcttcagctggattaataagagatcgctttctaaatgaaaattttgaaaaggtcatctat
caagcaatgcacaatcagtttgtagcagctgctgcaataacaaaatacattcatgaaact
tattctgatatacaggtaggttcaatgattacaagtacaatgatctatccttataatagt
gatccacgcaacagccttaagagcgttcagttaatgcgagaaagctataattttagtgat
attcaaattcgtggtaaatatcctctaaatttagtgccaaaattaaagaatttacatatt
aaaatatcaaaggaagacttagacttaattagtgaaaatacagcagattttattgcattt
tcatattactcttctgtttgcactgcttttgatacaaaaggattaaaagtaacaaaagca
aatcgtatggaaggggtttataacaaatatttacctaccagcgattggggatggcaaatt
gatcctattggtctaaggattatattaattaatttatacgatagatatcaaaagccccta
tttattgttgaaaatggattaggtgctaaggatagtctgactacaagtggaaaaattcac
gatgattatagaattgattatttacgacaacatattaaacagatgttagtctctatacaa
aacgatggaatagagcttatgggctattgtatgtggggaatgactgatatggtatcagca
tcgacaacacaaatttctaagcgatacggtttaatatatgttgatttagatgattttgga
gatggaacttataaacgatacttgaaagattcatatttttggtatcagaaacttttatct
tttaaaaataaaattcccaaagattttttagacaaataa

DBGET integrated database retrieval system