KEGG   Lactobacillus johnsonii NCC 533: LJ0544Help
Entry
LJ0544            CDS       T00158                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0544
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835953..1837431)
Genome map
AA seq 492 aa AA seqDB search
MKYYHVPEGFKWGVATAANQIEGAWNEDGKGISIADCERYDPEKARAGYKSANSMTSSEI
KRAMADKDSKRWGKRHGVDFYHQYPEDIKKLAATGINTFRTSIAWSRIFPNGDDIKPNEK
GLEFYDKLFDELHRYNIEPIVTLSHYEMPLNLVLNYDAWYDLRVREFFIKFAKIVIDRFH
GKVKYWIPINEIDSILRHPFSSAGLIRDRFLNENFEKVIYQAMHNQFVAAAAITKYIHET
YSDIQVGSMITSTMIYPYNSDPRNSLKSVQLMRESYNFSDIQIRGKYPLNLVPKLKNLHI
KISKEDLDLISENTADFIAFSYYSSVCTAFDTKGLKVTKANRMEGVYNKYLPTSDWGWQI
DPIGLRIILINLYDRYQKPLFIVENGLGAKDSLTTSGKIHDDYRIDYLRQHIKQMLVSIQ
NDGIELMGYCMWGMTDMVSASTTQISKRYGLIYVDLDDFGDGTYKRYLKDSYFWYQKLLS
FKNKIPKDFLDK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatcacgtgcctgaaggatttaagtggggtgtcgcaacggctgctaatcag
atagaaggagcttggaatgaagatggtaaaggaatttcaattgctgattgcgaacgctat
gatcctgaaaaagcgagagcaggctataagtcagcaaatagtatgacaagttctgaaatt
aaacgtgctatggcagataaagatagtaaacgttggggaaaaaggcatggagtagatttt
tatcatcaatatcctgaggatataaaaaaattagcggctacgggaattaatacttttaga
acttctattgcatggagtagaatttttccaaatggtgatgatattaagcctaatgaaaag
ggactagaattttatgataagttatttgatgagctacatagatataatattgaaccaata
gttactctatctcattatgagatgcccttaaatttagtattaaactacgatgcttggtat
gatttgcgcgttagagagttttttataaagtttgcaaaaattgtgatagatcgttttcac
ggcaaagttaaatattggattccgattaatgaaatagatagtattttgcgtcatccattt
tcttcagctggattaataagagatcgctttctaaatgaaaattttgaaaaggtcatctat
caagcaatgcacaatcagtttgtagcagctgctgcaataacaaaatacattcatgaaact
tattctgatatacaggtaggttcaatgattacaagtacaatgatctatccttataatagt
gatccacgcaacagccttaagagcgttcagttaatgcgagaaagctataattttagtgat
attcaaattcgtggtaaatatcctctaaatttagtgccaaaattaaagaatttacatatt
aaaatatcaaaggaagacttagacttaattagtgaaaatacagcagattttattgcattt
tcatattactcttctgtttgcactgcttttgatacaaaaggattaaaagtaacaaaagca
aatcgtatggaaggggtttataacaaatatttacctaccagcgattggggatggcaaatt
gatcctattggtctaaggattatattaattaatttatacgatagatatcaaaagccccta
tttattgttgaaaatggattaggtgctaaggatagtctgactacaagtggaaaaattcac
gatgattatagaattgattatttacgacaacatattaaacagatgttagtctctatacaa
aacgatggaatagagcttatgggctattgtatgtggggaatgactgatatggtatcagca
tcgacaacacaaatttctaagcgatacggtttaatatatgttgatttagatgattttgga
gatggaacttataaacgatacttgaaagattcatatttttggtatcagaaacttttatct
tttaaaaataaaattcccaaagattttttagacaaataa

DBGET integrated database retrieval system