KEGG   Lactobacillus johnsonii NCC 533: LJ0712Help
Entry
LJ0712            CDS       T00158                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ0712
   01230 Biosynthesis of amino acids
    LJ0712
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0712
  Energy metabolism
   00680 Methane metabolism
    LJ0712
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJ0712
Enzymes [BR:ljo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJ0712
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJ0712
  Exosomal proteins of melanoma cells
   LJ0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601590..602096
Genome map
AA seq 168 aa AA seqDB search
MRPLSIKGLEDRKKLVLYFKQKKIDVAYSSPFKRAIETIDPIVKDKQISCLIDENLRERK
IGNEWITNFNDYCKKQWENFEYHLSNGESLKEVQERNIKALENILEKNLNKTIIVGSHGT
AIGTIINYYDSSFTYEKFVKIQPLMPFVIKAKFKGLVLKEYNLDFFLR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccactaagtataaaaggattagaagatagaaaaaagctagttttatattttaag
caaaagaaaattgatgtagcatattctagtccttttaagagagcaattgagactattgat
ccaattgtgaaagataagcaaatttcatgtcttatagatgaaaatttacgtgagcgtaaa
attggtaatgaatggattacaaattttaatgactactgtaaaaaacaatgggaaaatttt
gaatatcatctttccaatggagaatctcttaaggaagttcaagagcgaaatattaaagct
ttagaaaatatcctagagaaaaacttgaataagactattatagtgggaagtcatggaaca
gctataggaacaataatcaattattatgattctagttttacttatgaaaaatttgtaaaa
attcagccattaatgccatttgttataaaagctaaatttaaaggcttggtattgaaggaa
tataatttagatttctttttaagataa

DBGET integrated database retrieval system