KEGG   Lactobacillus johnsonii NCC 533: LJ0712Help
Entry
LJ0712            CDS       T00158                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ0712
   01230 Biosynthesis of amino acids
    LJ0712
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0712
  Energy metabolism
   00680 Methane metabolism
    LJ0712
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJ0712
Enzymes [BR:ljo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJ0712
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJ0712
  Exosomal proteins of melanoma cells
   LJ0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601590..602096
Genome map
AA seq 168 aa AA seqDB search
MRPLSIKGLEDRKKLVLYFKQKKIDVAYSSPFKRAIETIDPIVKDKQISCLIDENLRERK
IGNEWITNFNDYCKKQWENFEYHLSNGESLKEVQERNIKALENILEKNLNKTIIVGSHGT
AIGTIINYYDSSFTYEKFVKIQPLMPFVIKAKFKGLVLKEYNLDFFLR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccactaagtataaaaggattagaagatagaaaaaagctagttttatattttaag
caaaagaaaattgatgtagcatattctagtccttttaagagagcaattgagactattgat
ccaattgtgaaagataagcaaatttcatgtcttatagatgaaaatttacgtgagcgtaaa
attggtaatgaatggattacaaattttaatgactactgtaaaaaacaatgggaaaatttt
gaatatcatctttccaatggagaatctcttaaggaagttcaagagcgaaatattaaagct
ttagaaaatatcctagagaaaaacttgaataagactattatagtgggaagtcatggaaca
gctataggaacaataatcaattattatgattctagttttacttatgaaaaatttgtaaaa
attcagccattaatgccatttgttataaaagctaaatttaaaggcttggtattgaaggaa
tataatttagatttctttttaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system