KEGG   Lactobacillus johnsonii NCC 533: LJ0738Help
Entry
LJ0738            CDS       T00158                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ljo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632667..634703
Genome map
AA seq 678 aa AA seqDB search
MKRALDINQFLHGGDYNPEQWWDEPDVINQDFALFKQAKINTVTVGIFSWAKLEPQEGNY
DFSWLDEIFDRVEEMNGHVILATPSGARPAWLAQKYPEVLRTDNRGNKRGFGGRHNHCLT
SPIYRKKVYEINTKLAEHFGQRKSLVLWHISNEYSGECYCDLCKDAFRKWLKNKYGDLAT
LNHAWWNTFWSHTYNDWSQVNPPSPLSEMGNKGMNLDWKRFITDQTISFIDNETAPLKKI
TPNIPVTTNMMAGNPLMDPFAGFDYQKVARHSDFISWDSYPAWSNDSQSTEELGRNIGLI
HDFFRSLKHQNFLVMENTPSRVNWHNFDRAKRPGMHELASLQDVAHGSQGVLYFQLRASR
GSSEMFHGAVIEHRHPEKTRAFKDVTKVGKDLEKISPIVATNYAKAKVAIVFSYDSYWAL
QDAESYSENKKVWQTIQKHYRYFYDHDIPVDFVSPEDEFSQYDLLIDPMHFLMSKSYLEK
IDNYVKNGGKIVGTYISGVVDENDLAYMNEWPKELQEIYGLEPLETDVLYPRQSNLINFE
GKEYPVHDYCETLINCTGKVLATYSTDFYQDTPAIVEHSYGAGKSYYLACRTDYSFLEKF
YEKIASELVPEIPITKFNDRVSIQIRENKSEKYWFVQNFSDKEEKIELSCELVNLLDNTK
ETGEVVLEPFESKVYKNN
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgccttagatattaaccaatttttacatggcggtgattataatcccgaacaa
tggtgggatgagcccgatgtaattaatcaagattttgctctctttaagcaggctaaaatt
aataccgtgactgttgggattttttcgtgggccaaattagaaccgcaagaaggaaattat
gatttttcttggttagatgagatttttgatcgagtagaggaaatgaatggtcatgtaatt
ttagctacgccaagtggagcacgaccagcctggcttgctcaaaagtatccagaagttctt
agaacagataaccggggaaataaacgtggctttggtggacgacataatcattgtttaact
tcacctatttatcgaaaaaaagtttatgagattaacacaaaactggcagaacattttggt
caaaggaaaagtttggtgctttggcatatttctaatgaatattcaggtgaatgctactgc
gatttatgtaaagatgcttttagaaaatggctgaaaaataagtatggcgatctagctact
ttaaatcatgcctggtggaacactttttggagtcatacttataatgactggagtcaagtt
aatccgcctagtcctttaagtgaaatgggtaataaagggatgaacttagactggaagaga
tttattactgaccagacaatttcatttattgataatgaaacagcacccttaaaaaagatc
actcctaatattcctgtaactacgaatatgatggctggaaatccgttgatggatccattt
gctggttttgattatcaaaaggtagcgcgtcattcggattttatctcttgggattcttat
cctgcttggagtaatgacagtcaaagtactgaagaacttggacgaaatattggattaatt
catgatttctttagaagtttgaagcatcagaactttttagtaatggaaaataccccatca
cgtgttaattggcataactttgatcgtgcaaaaagacctggaatgcatgaattggctagt
ctgcaagatgttgcgcatggtagccaaggagtattgtatttccaacttagagcttcgcga
ggatcatcagaaatgtttcatggggctgtaattgagcatcgtcatcctgaaaaaacgcgt
gcatttaaagacgtaactaaggttggtaaagacttggaaaaaattagcccaattgtagca
acaaattatgcaaaagcaaaagtcgcaattgtctttagctacgatagttactgggcactg
caagatgcggaaagttatagtgagaataaaaaggtctggcaaacaattcaaaagcattat
cgatatttttatgaccatgatattccagttgattttgttagtcctgaagatgagttttca
caatatgacttattgattgatccaatgcactttttaatgagtaagtcctatttagaaaaa
atagataattatgttaagaatggtggtaagatagtcggcacttatattagcggagttgtt
gatgaaaatgatcttgcctatatgaatgaatggccaaaagaactacaagaaatttacgga
cttgagcctcttgaaactgatgttttatatcctaggcaatcgaatttaattaattttgaa
ggaaaagaatatcctgtgcacgattattgtgaaacgttaattaactgcacgggaaaagtt
ttggctacatacagtacagatttttatcaagatacacctgctattgttgagcattcctac
ggagctggcaaaagctattaccttgcttgtcgtactgattattctttcttagaaaagttt
tatgaaaaaatagctagtgaattagttcctgaaattccaattacaaaatttaatgataga
gtttcaattcaaatacgtgaaaataagtcagaaaaatattggtttgttcagaatttttct
gataaagaagaaaaaattgaattgagttgtgaattagttaatttgctagataatacaaag
gaaacaggcgaagttgttttagaaccatttgaaagtaaagtttataaaaataattag

DBGET integrated database retrieval system