KEGG   Lactobacillus johnsonii NCC 533: LJ0797Help
Entry
LJ0797            CDS       T00158                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LJ0797
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LJ0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691521..692447
Genome map
AA seq 308 aa AA seqDB search
MNKVTIVGSINVDNIMHIKKLPQPGETIAMSEFSKAAGGKGANQAVASSRAKNETIFVGR
VGDDDNGRFMLEQFKENGINVDHVAVTPNQQTGQAYILLQETGQNSIIIQHGANFDVTAE
DVRNAKSQIEDSDFVIAQFETPIEATIEAFKIAREAGKITILNPAPARTDIPEELLELTD
LITPNETEAESITGIKVDSEESMKKSSEIFHQMGIKGVIITIGERGSYVSYEDIEEIVPA
FKVKAVDTTAAGDTFLGALSSELKPDLSNLRDGVIYASKSSSFTVQKLGAFPSIPTREVV
EEALKEKN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttacaattgttgggtcaattaacgttgataatattatgcatattaagaaa
cttcctcaaccaggagaaacaatagcaatgtctgaattttcaaaagctgctggtggtaag
ggagcaaatcaagccgtagcaagtagtcgagcaaaaaatgaaacaatttttgttggacgt
gttggggatgatgacaatggtcgctttatgcttgaacaatttaaagaaaatggaattaat
gttgaccatgtagctgtaaccccaaaccaacaaactggacaagcctatattttgcttcaa
gagacaggacaaaattcaattattattcaacatggtgcaaattttgacgtaacagcagaa
gatgttagaaatgcgaaaagtcaaattgaagatagtgattttgtgattgctcaatttgaa
acaccaattgaagcaacaattgaagcttttaagattgctagagaagctggtaaaattact
attttaaatcctgcgcctgcccgtactgatattccagaagaattattagaattaaccgac
ttgattactcctaatgaaactgaagctgagagtattacgggaattaaagttgacagtgaa
gagtcaatgaagaagagtagcgagatttttcatcaaatgggaattaagggtgtaattatc
acaattggtgaacgtggatcttatgtttcttatgaagatattgaagagattgttccagcc
ttcaaagttaaggcagttgatacaactgcagctggtgatacattcttaggtgcattatct
agtgaactaaagcctgatttaagtaacttaagagatggtgtgatttatgcatcaaaatca
tcctcatttacagttcaaaaattaggtgcatttccatctattccaactagagaagtagtt
gaagaagctttgaaggagaaaaactaa

DBGET integrated database retrieval system