KEGG   Lactobacillus johnsonii NCC 533: LJ0803Help
Entry
LJ0803            CDS       T00158                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LJ0803
Enzymes [BR:ljo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LJ0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696462..698867
Genome map
AA seq 801 aa AA seqDB search
MAVNYDSQEYLKSVDAYWRAANYLSVGQLFLMNNPLLKRELKAEDVKPKPIGHWGTIVPQ
NFIYGHLNRAIKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTERYPEITQDEKGMAKLFK
QFSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAILDNPDVIAAVEIGDGESETGPLA
TSWFSSKFINPIKDGAVIPILQINGFKISNPTIVSRMSDEDLTKYFEGMGWKPYFVSAYK
DGEFNGYKDHMEVHQEMAKTMDEVVEEIKAIQKHARENNDDSLVKWPMIVFRVPKGWTGP
KFDLDGNPIENSFRAHQIPIPVAQDDMNHKEMLTDWMESYKPEELFNEDGSPKDIVKENT
LSGDQRMAMNPVTNGGIDPKVLNMPDYRDFAIKFDKPGSVEKQDMAEWAKYLDKMSELNP
TNFRGFGPDETKSNRLFQLLDNQKRQWMESIHTPNDENLAHEGRVIDSQLSEHQDEGWLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQAWRHDYPALNLVDTSTVFQQDH
NGYTHQDPGMLTHLYEKNRPDLIHEYLPADTNSLLAVSDKAFRDRECINVLVTSKQPRPQ
WFSIEEAKKLVDKGLGYVDWASTDKGAKPDVVFASTGTEPTIESLAAIDLLHKKFPDLKI
RYINVIDVMKLMSPEKNPNAISNEEFNRLFPKGTPVIFAWHGFKPMMESIWFDRGRGKDD
VHIHGYEENGDITTPFDMRVLNHMDRYDLAKDVVESIPELNEKNADFIDEMDSLLAKHHQ
YIRDNGKDMPEVTEWQWNGLK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaattacgattctcaagaatacttaaagagtgttgacgcatactggcgtgca
gctaactacttatcagtgggacaattatttttaatgaataatcctttacttaaaagagaa
ttaaaggcagaagatgtaaaacctaagccaattggtcactggggtacaattgtgccgcaa
aactttatttatggacatttaaatcgtgcaattaagaaatatgatttaaacatgttctac
attgaaggttctggtcacggtggtcaagtaatggtatcgaactcatatttagatggttct
tatactgaacgctacccagaaattactcaagatgaaaagggaatggctaagttatttaag
caatttagttttccaggtggagttgcgtctcatgctgctccagaaactcctggatcaatc
catgaaggtggagaattaggctactcactatctcatggtgttggtgcaattttagacaat
ccagatgtaattgctgcagttgaaattggtgacggtgaatcagagactggtccacttgct
acttcttggttttcaagtaagttcattaatccaattaaagatggtgcagttattcctatc
ttgcaaatcaatggctttaagatttctaacccaactatcgtttctagaatgagtgacgaa
gacttaactaagtactttgaaggaatgggttggaagccatactttgtttctgcatataaa
gacggtgaatttaatgggtataaagaccacatggaagttcaccaagaaatggcaaagaca
atggacgaagttgttgaagaaattaaagctattcaaaagcatgcgcgtgaaaacaatgat
gattccttagtgaagtggccaatgattgtctttagagtacctaagggttggacgggtcca
aaatttgatctagatggcaatccaattgaaaatagtttccgtgctcaccaaattccaatt
cctgttgctcaagatgacatgaatcataaagaaatgcttactgattggatggaaagttat
aagccagaagaattattcaatgaagatggctcaccaaaagatatcgttaaagaaaatacc
ttatcaggcgaccaaagaatggctatgaatccagtaactaatggtgggattgatccaaaa
gtcttaaatatgcctgactatcgcgactttgcaattaaatttgataagcctggatctgtt
gaaaaacaagatatggccgaatgggcaaaatatttagacaagatgtctgaattgaaccca
actaatttccgtggttttggtcctgatgaaactaaatctaatcgtttattccaactttta
gataatcaaaaacgtcaatggatggaaagtattcatactccaaacgatgaaaacttggct
cacgaaggtcgtgtaattgactcacaattgtcagaacaccaagatgaaggttggcttgaa
ggatatgtattaactggtcgtcacggattctttgctacttatgaagcatttggtcgtgta
gttgattcaatgcttacgcaacatatgaaatggttgagaaaagctaaagagcaagcttgg
agacatgattatccagccttaaacttagttgatacttcaactgttttccagcaagatcac
aatggttatactcaccaagatccaggtatgttaactcatttgtatgaaaagaatcgtcca
gatttaattcacgaatacttaccagcagatactaattcacttcttgctgtatctgataag
gcatttagagatcgcgaatgcatcaatgttttagtaacttctaaacaacctcgtcctcag
tggttctcaattgaagaagctaaaaaattggttgataagggtcttggttatgttgactgg
gcatcaactgataagggcgctaagccagatgttgtttttgcttcaactggtactgaacca
acaattgaatctttagctgccattgacttacttcataagaaattcccagacttaaagatt
cgctatattaatgtaattgatgttatgaagttaatgtccccagaaaagaatccaaatgca
atcagtaatgaagaattcaaccgtcttttccctaaaggtacaccagttatctttgcatgg
catggatttaagccaatgatggaatcaatttggtttgatcgcggccgtggtaaagatgat
gttcatattcatggctatgaagaaaatggtgacattactactccttttgatatgcgtgtc
ttaaaccacatggatcgctatgacttagcaaaagatgtagtagaaagtattcctgagcta
aatgaaaagaatgcggatttcattgatgagatggatagcttgcttgctaaacaccatcaa
tatatccgtgataacggtaaagatatgcctgaagttactgaatggcaatggaatggttta
aaataa

DBGET integrated database retrieval system