KEGG   Lactobacillus johnsonii NCC 533: LJ0855Help
Entry
LJ0855            CDS       T00158                                 

Definition
beta-galactosidase large subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LJ0855
  Lipid metabolism
   00600 Sphingolipid metabolism
    LJ0855
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LJ0855
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LJ0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(751982..753862)
Genome map
AA seq 626 aa AA seqDB search
MKANIRWLDDPETFRVNQIAAHSDHLYFKNYEEWEQKRSSFIQSLDGKWQFKFSNNPQTR
PLDFYKTNFDASDFDFIPVPSEIELNNYAQNQYINTLYPWEGKIFRRPAYSLGQKTDRSF
SGGEDNTVGSYIKHFDLDNSFQGKHVHVFFEGVERAMFVWLNGHFIGYGEDSFTPSEFDL
TPYLKEKNNILAVQVFKHSTASFLEDQDMFRFSGIFRSVKLLAFPETHLMDLALKPTITN
DYHDGIFNAKLSFTGTKDGYVRLKIKDINGQTLLDEEHNLTSTITIENKLLKNIHLWDNH
HPYLYQLFIEVHDSNKNLIELDSYKFGFREIKITDDKVVLLNGKRLIINGVNRHEWNMNS
GRTITKQDMKADIQTFKRNNINAVRTCHYPNQIPWYYLCDQNGIYVMAENNLESHGTWQK
MGKVEPSYNVPGSLAEWRNVVIDRARSNYETLKNHTSILFWSLGNESYAGENLIAMNQFY
KSHDDTRLTHYEGVVHTPDLKNKISDLESYMYLPPKEAEKYLKNNPSKPFLECEYMHDMG
NSDGGMKSYIKLIDEYPQYLGGFIWDFIDQALLTYDPISGKKVLRYGGDFDDRHSDYEFS
GDGLMFADRTEKPAMQEVKYYYGLHK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaatattcgatggctagatgatccagaaactttccgcgttaatcaaattgca
gcgcacagtgatcatttatatttcaaaaattatgaagaatgggaacaaaaacgtagcagt
tttattcaaagtctagatggaaaatggcaatttaaattttctaataatccccaaactaga
ccacttgatttttacaaaactaattttgatgcttcagattttgatttcattcctgttcca
agtgaaattgaattaaataattatgcacaaaatcaatatataaataccctctatccttgg
gagggaaaaatttttcgcagaccagcttattcgctaggacagaaaacagatcgttcattc
agtggaggagaagataatacggtcggttcttacattaaacattttgatttagataattct
tttcaaggaaagcacgttcatgttttctttgaaggagtagaacgagcaatgtttgtttgg
ctaaatggtcattttattggatatggtgaagatagttttactccatctgaatttgatctt
accccctaccttaaagaaaagaacaatattttagctgtacaagtattcaaacacagtact
gcctcttttttagaggatcaggatatgtttagattttctggaattttccgctcagtaaag
ctacttgcttttccagaaacacatttaatggatcttgcattaaaaccaacaattacaaat
gactaccatgatggaattttcaatgccaaattatcctttactggtacaaaagatggatat
gtacgtttaaaaataaaagatatcaatgggcaaactttactggatgaagaacataatcta
acttcaacaattacaatcgaaaataaattactgaaaaacattcatctttgggataaccat
cacccttatttatatcagttatttattgaagtccacgattcaaataaaaatctaattgag
ttagattcttataaatttggatttcgagaaattaaaataactgacgataaagttgtatta
ctcaatggaaagagactaattataaatggggtcaaccgacacgaatggaatatgaatagc
ggacgtaccattactaaacaggatatgaaggccgatattcagacctttaaaagaaacaat
atcaatgcggtacgtacttgccattatcctaatcaaattccgtggtattacttatgtgat
caaaatggtatctacgttatggcagagaataatttagaatctcacggaacatggcaaaaa
atgggaaaagttgagccttcgtataatgttccaggatctttagcagaatggcgtaatgta
gttattgatcgtgccagaagtaattatgaaactttaaagaatcatacttctattctcttt
tggtcgctaggtaatgaatcatatgctggtgaaaatttaatagcaatgaatcaattctat
aaatcgcacgatgatacacgccttacgcattatgaaggtgtggttcatacaccagactta
aaaaataaaatatctgatttagaaagttacatgtatctcccacctaaagaagctgaaaaa
tatttaaaaaataatccttcaaagccatttcttgaatgcgaatatatgcatgatatgggc
aattcagatggtggaatgaaatcttacattaaattaattgatgaatatccacaatattta
ggcggatttatttgggactttattgatcaagctcttttaacctatgatccaataagcggt
aaaaaagtactcagatacggtggtgactttgatgatcgacactcagattatgagttttct
ggggatggtctaatgtttgctgatcgaactgaaaaaccagcaatgcaggaggttaaatat
tattatggattacacaaataa

DBGET integrated database retrieval system