KEGG   Lactobacillus johnsonii NCC 533: LJ0874Help
Entry
LJ0874            CDS       T00158                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ0874 (tpiA)
   01230 Biosynthesis of amino acids
    LJ0874 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ0874 (tpiA)
   00051 Fructose and mannose metabolism
    LJ0874 (tpiA)
   00562 Inositol phosphate metabolism
    LJ0874 (tpiA)
Enzymes [BR:ljo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LJ0874 (tpiA)
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LJ0874 (tpiA)
  Exosomal proteins of bladder cancer cells
   LJ0874 (tpiA)
  Exosomal proteins of melanoma cells
   LJ0874 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779566..780321
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTIEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKTAEGSNLH
TGAENAYFEVEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQDEWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacacatgaaccctgaacaaaccatt
gaatttgttaatgcagttaagggtaagttgccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttatgttttaaagaagactgctgaaggctcaaacttacat
actggtgcagaaaatgcatactttgaagttgaaggtgcctttactggtgaaacttcacct
aaagttttgaatgaaatgggtattgactactgtattattggtcactcagaacgtcgtggt
tacttccacgaaactgatgaagacattaacaagaaagctaaggctttatttgctaatggc
gtaactccaatcatttgctgtggtgaatctcttgaaactcgtgaagctaacaagcaagat
gaatgggtagtagctcaaattaaagctgctttagatggcttaactgcagaacaagtttct
aaacttgttattgcttacgaaccaatttgggctatcggtactggtaagactgcttctgct
gatcaagctgaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaatgaa
gaaactgctgaaaacgttcgtatccaatacggtggttcagtaaaaccagctaacgtaaaa
gaattaatgtctaagcctgacattgatggtggtttagttggtggtgcttctcttgatcca
gaatcattcttagcattggtaaactaccaagattaa

DBGET integrated database retrieval system