KEGG   Lactobacillus johnsonii NCC 533: LJ0989Help
Entry
LJ0989            CDS       T00158                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LJ0989
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LJ0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889455..891830
Genome map
AA seq 791 aa AA seqDB search
MAETSFTGRINGIVFENNQDLFKIIDVDLISKLPDYDRDNIRVTGNFGDIQIGSTYKFTG
NIVVHEKFGKQFRIRSYEPVLPHEEGSLAKYLSSDKFPGIGKRAAEKIIDSLGTNALDLI
KSNPTEIDNLDLTQKQKDSLLSGINQMDSFSEIVIKLARYGINKKVAGNIYKVYHGDSLK
KLEEDPYQALGEVRGFGFKTADNMGHALGIELNDPRRVRGALLSILQTALNTLGDTYVAL
DELLTQAYDLVQSTSYDELANSVNELQRQGKVVVSGDKAALQTIFQTELDIATELKHVVN
NQVEKEEFDDSDIEKAIKHVEETLEIEYDDTQKNAIKNALNNPISILTGGPGTGKTTIIN
GILMCLKELAEIPSAALYSDDPPFLLAAPTGRAAKRMSEVTDISAKTIHRLLGLGIGENE
ATDVNELNGEILIIDEMSMVDMFLFKQLLSGINSTKRIVFVGDKDQLPSVGAGNIFSDLI
SSGAFPTTKLQVIHRQGEDSSIIKLAHAINDEEAEETIFNKTKNYSFIPCQPSLVGDAID
QIVNLAIKRGFKKDDIQVLGAMYNGQGGITHLNDILQDVMNPLSAKTKVIEAHNESFRIG
DRILQLQNNPEKDIYNGQIGKIIGLNPDDKAKILIADFDGREIEFGIKDLNDITRAYAIT
IHKSQGSEFPLVILNLTMQNYMMLRRNLLYTAITRAEKNLVMVGEKKAYIMALRTPGNDR
KTELAAKIRYELGLKEVENTSNVNAEQEKNKAELKEENVEPENYILTPELIYSGQIDPMI
GMEDIRLEEKR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactagttttactggacgaataaatggaattgtttttgaaaacaatcaagat
cttttcaagattattgatgtagatttaatcagtaaattacctgattacgatcgtgataat
atccgagtaactggaaattttggggatatccaaattggatcaacttataaatttaccggt
aatattgtcgtgcacgaaaaatttggtaaacaatttcgtataaggtcttatgaaccagtt
ttgcctcatgaagagggtagtttagctaaataccttagttctgataagtttcctggaatc
ggtaagagggctgctgaaaagatcattgatagtttaggaaccaatgcgttagatttgatt
aagtcaaatccaactgaaattgacaatcttgatttaactcaaaagcaaaaagatagctta
ttatctggaattaatcagatggattctttttcagagattgtgattaagctggctagatat
gggattaacaaaaaagtagctggtaatatttataaagtatatcatggtgattccttgaag
aaattagaggaagacccttatcaagctcttggtgaagttcgcggctttggttttaaaact
gcagacaatatgggacacgcgctcggaatagaactaaatgatcctagaagagttagggga
gcacttctaagtattttacagactgctcttaataccttgggagatacttatgttgcactt
gatgaattattaacacaggcttatgatttagttcaatctacctcttatgatgagcttgct
aatagtgttaatgaacttcaaaggcaaggaaaagttgttgtttcaggtgataaggcagct
ttgcagacaatttttcaaactgaacttgatatagccactgaattaaaacatgtagttaat
aatcaagtcgaaaaagaagaatttgatgatagcgatattgaaaaagcaataaagcatgtc
gaagaaacacttgaaattgaatatgatgatactcaaaaaaatgcaattaaaaatgcgtta
aataatccaatttcaattcttactggtggtcctggtactggtaaaacgacaattattaat
ggaattttaatgtgtttaaaggaacttgcggaaattccaagtgcagctttgtatagcgat
gatccaccatttttacttgctgcaccaacgggtcgagctgccaagcgaatgagtgaggtt
acagatatttcagcgaaaaccattcaccgtttattagggttaggcatcggtgaaaatgaa
gcgactgatgtaaacgaattaaacggtgagatcttaattattgatgaaatgtcgatggtt
gatatgtttctctttaaacagcttttatccggtattaattcaacaaagaggatagttttt
gtgggggacaaagatcagcttccttcagttggagcgggtaatattttcagcgatttaata
agttcaggggcatttccaactacaaagttgcaagtaattcatagacagggagaagactcc
tcaattattaagttggcccatgcaattaatgatgaagaagcagaagagactatttttaat
aaaactaaaaattactcctttattccatgtcaaccaagcttggtgggggatgcaatcgat
caaatcgtaaatttggctattaaacgtggtttcaaaaaggatgatattcaagttctggga
gcgatgtacaacggtcaaggtggaattactcacttgaatgatattttgcaggatgtgatg
aatccactatcagcaaaaactaaagtaattgaagctcacaatgaaagttttagaatcggg
gaccgaatcctacaattacaaaataatccagaaaaagatatttataatggtcaaattggt
aaaattattggccttaatcctgatgataaagccaaaatattaattgctgattttgacggt
cgtgaaatagaatttggtattaaagacttaaatgatattacccgtgcgtatgccattacc
atccataagtcccaaggatcagaatttccgttagtaattttaaatcttacgatgcaaaat
tatatgatgttgaggcggaatttgttatataccgccattactcgtgctgagaagaattta
gttatggtaggagaaaaaaaggcgtatattatggcattgcgtactccaggtaatgaccgt
aagactgagttagcagctaaaattaggtatgagttaggtctaaaagaagttgaaaatact
tcaaatgtaaatgcggaacaagaaaaaaacaaagctgaacttaaagaagaaaatgttgag
ccagaaaattatattttgactcctgagctaatttattctggacagattgatccaatgatt
ggaatggaagatattagattagaagaaaaaagatag

DBGET integrated database retrieval system