KEGG   Lactobacillus johnsonii NCC 533: LJ1051Help
Entry
LJ1051            CDS       T00158                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ljo00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ljo00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950198..950806
Genome map
AA seq 202 aa AA seqDB search
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKG
VLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSDSKTYGKWYGVELTAENKKQFLIPQGF
AHGFLVLSDEAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDD
GTKLTLSDRDQEWKGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaattaaagttgaaaaaaatgttggtggaattgaaggtttagcagttatcact
ccaactgttcacggtgatgaccgtggttacttcatggaaacttttaaccaaagagatatg
atggatgctggcttcagcattaacttcgttcaagataaccaatcaagctcaactaagggt
gtacttcgtggtttacacttccaaaagaaatacccacaaattaagttggttcgtgctgtt
cgtggtagtgtatttgacgttgctgttgaccttcgtagcgactcaaagacttacggtaag
tggtacggtgttgaattgactgctgaaaacaagaagcaattcttaattccacaaggtttt
gctcatggtttccttgttttaagtgatgaagcagaattctgctacaaggttaacgatttc
tggcatccaaacgatgaaggtggtatggcctggaacgatcctgaaattggtatcgaatgg
ccacatcttaagggtgattacccgggcagtccagatgctagtggttacactcttgatgac
ggtactaagcttactttatctgaccgtgatcaagaatggaaaggcttaaaggatactttt
aagttttaa

DBGET integrated database retrieval system