KEGG   Lactobacillus johnsonii NCC 533: LJ1079Help
Entry
LJ1079            CDS       T00158                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LJ1079
   01230 Biosynthesis of amino acids
    LJ1079
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ1079
   00030 Pentose phosphate pathway
    LJ1079
   00051 Fructose and mannose metabolism
    LJ1079
   00052 Galactose metabolism
    LJ1079
  Energy metabolism
   00680 Methane metabolism
    LJ1079
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LJ1079
Protein phosphatases and associated proteins [BR:ljo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LJ1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983155..984114
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADK
ISRGGTFLYSARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTRHGYNAI
GLPGSIDNDIPYTDYTIGFDTACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHV
GVATGADAIVIPEEPYDIKEIAENLKQGFANGKKHGIVVLAEGVMDAEKFKDELLKYGDF
DARANVLGHMQRGGSPTMRDRVVASEMGAYAVKLLLEGKGGLAVGMENNKLTHHDILDLF
DAKHHGNYALYSLNKDLAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagatgcccctggtatgaacgctgccatt
agagctgtcactcgtacagctttggcaaacggtatcgaagtttgcggaattcgttatgga
tatgctggtttagttgctggtgatattttccaaatgacttctgaaacagttgcggataaa
attagccgcggcggtacttttctttattcagctcgtttcccagaatttaaggaagaagaa
gttcaacttaagggaatcgaacaattaaagaagcacggaatcgatgctttggttgtcatt
ggtggtgacggttcttaccacggtgcattgaagcttacaagacatggctataatgctatt
ggtcttcctggttcaattgataacgatattccttatactgattacacaattggttttgac
actgcatgtaatactgcaatggaagccattgataagatccgtgacactgcaacaagtcac
caacgtgtatttgttgtaaatgttatgggtcgtgattgtggggatatcgcaatgcacgtt
ggtgttgctaccggtgctgacgcaattgttattccagaagaaccttatgacattaaggaa
attgctgaaaacttgaagcaaggatttgctaatggtaagaaacatggaatcgttgtttta
gctgaaggtgttatggacgctgaaaaatttaaggatgaacttcttaaatatggtgacttt
gacgctcgtgctaatgtattgggccatatgcaacgtggcggaagcccaacaatgcgtgac
cgtgtagtagcaagtgaaatgggtgcctacgctgttaagttattacttgaaggtaaaggc
ggcttagctgttggtatggaaaacaacaagcttactcaccatgatattcttgatttgttt
gatgcaaaacaccacggtaattatgcgttatactcattaaacaaagacttagccaagtag

DBGET integrated database retrieval system