KEGG   Lactobacillus johnsonii NCC 533: LJ1120Help
Entry
LJ1120            CDS       T00158                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LJ1120
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ1120
  Lipid metabolism
   00071 Fatty acid degradation
    LJ1120
  Amino acid metabolism
   00350 Tyrosine metabolism
    LJ1120
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LJ1120
   00626 Naphthalene degradation
    LJ1120
Enzymes [BR:ljo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LJ1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1024927..1025967
Genome map
AA seq 346 aa AA seqDB search
MKYAEFVKAGEMKIIDKPMPKIEKNDDVIIKVVRTCVCGSDLWAYNGVEEQGHENGGHEV
IGIVQEIGKDITTVKKGNFVIAPFTHGCGHCRACLAGFDGVCMSHDLSENFSNGYQAEYV
RFQHAQWSLVKIPGKPDDYTEGMLKSFLALADVMATGYHAARVADVQPGDSVIVLGDGAV
GLSAIIAAKLRGAKQIVSTSRHADREALAREFGATENVAERDEEGIQNLLAITRSGADAV
LECVGSKLSNEEALQVGRPGSRVGRVGLPHGAELNPGLIFYKNMSVAGGPASVTTYDKQV
LLTAVLDGRINPGKVFTKTFTLDQINEAYQEMADRKAIKSYIKVND
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgcagaatttgttaaagctggcgaaatgaaaattattgataagccaatgcct
aaaattgaaaaaaatgatgatgtaattattaaggtagttcggacttgcgtttgcggctca
gacttatgggcttacaatggtgtagaagaacaaggtcatgaaaatggcggtcatgaagtt
attggaatcgtccaagagattggtaaggatattactacagttaaaaaaggtaattttgta
attgcaccatttactcatggttgtggccactgccgagcatgcttggctggatttgacggg
gtatgtatgagccatgatttaagtgaaaatttctctaatggttatcaagcagaatatgta
cgtttccagcatgcgcaatggtcattagttaaaattccaggtaaaccagatgactatact
gaaggaatgttaaagtcattcttagccttagcagatgtaatggcaactggataccatgca
gctcgtgtagctgatgttcaaccaggagattcagtaattgttttaggtgatggagcagta
ggcttatccgcaatcattgcagctaaattacgtggtgcaaaacaaattgtttctactagt
agacatgcagaccgtgaagctttagcccgtgaatttggtgcaacggagaatgtagctgaa
cgcgatgaagaaggaattcagaacttacttgcaattactcgcagcggagctgatgcagta
ttagaatgtgttggaagtaaactatctaacgaggaagctttgcaagttgggcggcctgga
tctcgcgttggacgtgtaggattacctcatggagctgaattaaatccaggtttaattttt
tacaaaaatatgagcgtagctggtggaccagcatcagtaactacctatgataagcaagtc
ttactaacagcagtcttagatggtaggatcaatccgggaaaagtatttacaaaaacattt
actctcgatcaaatcaatgaagcttaccaggaaatggctgatcgaaaagcaattaagtca
tatattaaagttaatgattaa

DBGET integrated database retrieval system