KEGG   Lactobacillus johnsonii NCC 533: LJ1268Help
Entry
LJ1268            CDS       T00158                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LJ1268
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LJ1268
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJ1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194657..1196108
Genome map
AA seq 483 aa AA seqDB search
MTEKYILAIDQSTQGTKVLLINHQNQIFFKASLSHQQLINENGWVSHNLNEIKNNLKQLF
KQILEKVDSRQLEAVAITNQRESAAAWSRRTGEPLCYTIVWQDNRSEQLINQITYPELAR
KVKNKTGLALSPYFTGAKWGWMLLNEPRVIQAHANNDLCLGTIDSWLVYQLTNGESFKTE
VSNACRTELMNIKTGTWDQDLGEIFGIDLNDLPKIVDSNANFGETNLFGLIPHKIPILSV
LGDSQAALFAHGCFNPGDFKVTFGTGSSVMLNIGNNLPKNINNQLNTSLAWSINGKKSYV
LEGNINYAGACVTWLKDKLHLIHDPSDTTMLALTANPNDHTILIPAFAGLGAPYWLPNMK
AAFVNMTATTGKKELVRATLNSLVYQINDILQAFHHFSSQVNSEIHADGGMIQNKYLMQY
LSNITQKNVKIAEVAELSALGTAMNSMQQFDGMHYSKTYIPRMDKHAANKYSSEWSSWIK
KLS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaatatattttagcaattgatcaaagcacccaaggaactaaggtacttcta
atcaatcatcagaatcaaattttcttcaaggcttccctttcccaccaacagctcattaat
gaaaatggctgggtgagtcataatttaaatgaaataaaaaataatctaaaacagctattt
aagcagattcttgaaaaagttgattctagacaacttgaagccgtcgctattaccaaccaa
cgtgaatcggcagctgcctggtctcgaagaactggtgaaccgctttgctatactattgtt
tggcaagataatcgctcagaacaattaatcaatcaaattacatatccagaattagctaga
aaagtaaaaaacaaaactggtttagctctttctccatattttactggagccaaatggggt
tggatgcttttaaatgaacccagagtgattcaagcacatgctaacaatgacctctgctta
ggaacaatagactcttggctagtttatcaactcactaatggcgaatcttttaagactgaa
gtttctaatgcttgtcgaactgagctaatgaatataaaaactggaacatgggatcaggat
ttaggtgaaatttttggtattgatctcaatgatcttcctaaaattgttgattcaaatgct
aattttggtgaaactaatttatttggtctcattcctcataaaattcctattcttagcgtt
ttaggtgattctcaagctgccttatttgctcatgggtgttttaatcctggtgactttaaa
gttacgtttggaactggttcttctgtgatgttaaatataggtaataatttaccaaaaaat
attaataatcagcttaatacatctcttgcctggtcaattaatggtaaaaaatcttacgtt
cttgaaggaaatattaattatgcaggagcttgcgttacatggttaaaagacaagctacat
ttaattcacgatccgtctgatactactatgctggccctaaccgctaatccaaatgatcat
actattttaattccggcttttgctggacttggcgctccttattggctccctaatatgaaa
gctgcatttgttaatatgacagctaccactggtaaaaaagaattagtacgtgccactcta
aattcattagtttatcaaatcaatgatattctacaggcatttcatcacttttcttctcaa
gtgaacagtgaaattcatgctgatggtggaatgatacaaaataaatatttaatgcaatat
ttaagtaatatcactcaaaaaaatgtaaagattgctgaagtcgctgagttaagtgctctg
ggaactgcgatgaattcaatgcaacaatttgatgggatgcattattctaaaacttatatt
cctcgaatggacaaacatgcagcaaataagtattcaagtgaatggtcttcttggataaaa
aaattatcataa

DBGET integrated database retrieval system