KEGG   Lactobacillus johnsonii NCC 533: LJ1395Help
Entry
LJ1395            CDS       T00158                                 

Definition
hypothetical protein
Organism
ljo  Lactobacillus johnsonii NCC 533
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1266819..1267199)
Genome map
AA seq 126 aa AA seqDB search
MKKNSEEKKNFNFKASWSKINEKSFMPLIWLTLLGVIVWIICPLVHLSRVWRIGLVFFIF
NTYLSYQIGRIMQIRKLSCWWLLLFPVVFAIAVFIHFAKYNFLLCLVYLSFELFGLWHDD
FYKEKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatagtgaagaaaagaaaaattttaattttaaggcttcatggagtaaaata
aatgaaaaatcatttatgcctcttatttggttaactttattaggagtaattgtttggatt
atctgtccactcgttcatctaagtcgagtttggcgaattggactagttttctttattttt
aatacttatttaagctaccaaattggtcgtattatgcaaattagaaagttaagctgttgg
tggctacttctttttcctgtagtttttgctattgcagttttcattcactttgctaaatat
aacttcttattgtgcttagtatatttaagttttgaattatttggtttatggcatgatgat
ttttacaaagaaaagaaataa

DBGET integrated database retrieval system