KEGG   Lactobacillus johnsonii NCC 533: LJ1470Help
Entry
LJ1470            CDS       T00158                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ljo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ljo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335313..1335816)
Genome map
AA seq 167 aa AA seqDB search
MIRFIWAEDENGCIGYQGALPWHLPADLKHFKELTSNHIIVMGRKTFDSFPGLLPKRKHI
ILSTNPILQRRYQDNSDVKVFSQIEQLKNWIEDHTEEIIDIIGGAEVFKEFKDEVDVLEK
TKIHHIFKCDTWMPELKYEDFKLVNSESHHPNGNNKFDYDFLEYKRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgattagatttatttgggcagaagatgaaaatggatgtattggttaccagggtgctttg
ccctggcatttgcccgctgatttaaaacattttaaagagctgactagtaatcatattatc
gttatgggacgaaaaacatttgatagttttcccggattacttcctaaaagaaaacatatc
atcctttctactaatccaattttacaacgtagatatcaagataattcagatgttaaagtt
ttttcacaaattgaacagttgaaaaattggatcgaagatcacactgaagaaataattgat
attattggtggtgctgaagtttttaaagaatttaaggatgaagtagatgttcttgaaaag
acaaaaattcaccatatatttaagtgtgatacatggatgccggaactaaagtatgaagac
tttaaattagtaaattccgaaagtcatcatccaaatggaaataataaatttgattacgac
tttttagagtataagagaatatga

DBGET integrated database retrieval system