KEGG   Lactobacillus johnsonii NCC 533: LJ1593Help
Entry
LJ1593            CDS       T00158                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LJ1593
   00052 Galactose metabolism
    LJ1593
   00500 Starch and sucrose metabolism
    LJ1593
   00520 Amino sugar and nucleotide sugar metabolism
    LJ1593
Enzymes [BR:ljo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LJ1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467932..1468837)
Genome map
AA seq 301 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNK
RSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSF
VGDEPFAVMLGDDLMEDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDSEIE
PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLREYIINMAQKLQKEDKNSKK
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagttattccagcagctggattaggtactagatttttacctgcc
actaaggctatgcctaaggaaatggtaccgattgttgataaaccaacaattcaatttatt
gtagaagaagctaaaaaatctggaattgaagatatcttgatcgttactggtaaaaacaag
cgttctatcgaagatcactttgatgctaacccagaactagaacaagatttggaagaaaag
ggtaaaactgaacttttacacttaacccaatcaattactaatttaggtgttaacctttac
tacactcgtcaaccacacccagctggtttaggggatgcgattttaagagctcgtagcttc
gttggggatgaaccatttgctgttatgcttggtgacgacttgatggaggacaaggttcca
ctaactaagcaattgattgatcgttatgacaagactcatgcatcaactattgctgttatg
cctgtaccacatgaagaagtttctaagtatggtgttattgatccagatagcgaaattgaa
cctggtttaattaacgttaaggcctttgttgaaaagccagacgttgataaggcacctagt
gactacgcaattattggtcgttacttgttaactcctgaaatttttgatattttagcacat
caaaaacctggtcgtggtggcgaaattcaattaactgacgcaattgatactatgaacaag
actcaacgagtattcgctcatgtatttaatggtgaacgtcacgatgttggtaacaaggaa
ggttaccttgaaacatcaattgaatatggtttatctcaccctcaaattaaagatgattta
cgtgagtacattattaacatggctcaaaaattacaaaaagaagataaaaactcaaagaag
aaataa

DBGET integrated database retrieval system