KEGG   Lactobacillus johnsonii NCC 533: LJ1766Help
Entry
LJ1766            CDS       T00158                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LJ1766
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ1766
   00620 Pyruvate metabolism
    LJ1766
   00650 Butanoate metabolism
    LJ1766
  Lipid metabolism
   00071 Fatty acid degradation
    LJ1766
  Amino acid metabolism
   00350 Tyrosine metabolism
    LJ1766
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LJ1766
   00626 Naphthalene degradation
    LJ1766
Enzymes [BR:ljo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LJ1766
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LJ1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1655304..1657913)
Genome map
AA seq 869 aa AA seqDB search
MVQDKKATKEEKAIDVNKMIDGYVEKAHVALDEMANFDQEQVDKICEAIASAGEQNSYLL
AKMAVEETGRGVVEDKTIKNMFASENIWNSLRHEKTVGVIEEDKEKQLVKIAEPKGVIAG
VTPVTNPTSTVIFKAMLALKTRNAIIFGFHPQAQKSCVKTGEIIREAAIKAGAPKDAIQW
IEYPSLEATSTLMNHPNVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKTANIPE
SVYDIVLSKTFDNGMICSSENSVVVDEDIYNEVKDEFKSWNCYFLKPDEIKKFEEKFIDP
KRGTVAGPVAGRSAYQIAKLCGVDVPEDTKVIIAEYKGVGKKYPLSAEKLSPVFTMYKAK
GHEDAYKICTDLLNYGGRGHTAGVHSQDEKVIDEFSMKMDACRILVNSPASVGGVGDLYN
NMLPSLTLGTGSYGANTFSHNIGARDLLNIKTVAKRRDNMQWIKVPKKTYFEHNAANYLK
HMPDVERFFIVTDEGVASKYINEITDIISQRRGKKSYEVFQAVTKDPDTDIIADGVHRMN
IFKPDVVIAIGGGSVMDAAKAMRLFYENPDMSFEDAYSKFLDIRKRTVRFPKYNAIQLVC
IPTTSGTGSEVSPFSIIKDAKTGIKHTLCDYSLNPDVAIVDDQFVETMPKELIARSGFEA
LAHAVESYVSTMATDFTRGWSMEAIKLIFENLEKSYNGDQNARSRMHNAATLAGMAYANA
FLGVGHAIAHTESSEFGIPSGLSDAIAMPYVIRFNSKKPRKLAMRPHYSTFRADKDYAEI
ARSLGLKGNSDQELIDALIKKVVELGHAVGMKLSLKANGISEADFNNKVENMAVEAYGDQ
NVVTNPSALLISEIKNLMKETYTGKGIEA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagataaaaaggcgacaaaagaagaaaaagcaattgatgtaaataaaatgatt
gatggctatgtagaaaaagcccatgttgctttagatgagatggccaattttgatcaagaa
caagttgataaaatttgtgaagctatcgcaagtgcaggggaacagaatagttatttactt
gcaaaaatggctgttgaagaaactggtcgtggagtagtagaagataagactattaaaaat
atgtttgccagtgaaaacatttggaatagtcttcgtcatgaaaaaactgttggtgttatt
gaagaagataaagaaaaacaattagttaaaattgcagaacctaaaggcgtaattgctgga
gtaactcccgttactaacccaacctcaactgtaatttttaaagctatgcttgctttaaaa
actagaaatgctattatttttggcttccacccacaagcacaaaagagttgtgtaaaaact
ggtgaaattattcgagaagcagcaattaaagctggtgctcctaaagatgctattcaatgg
atcgaatatccaagtcttgaagcaacaagtactttaatgaatcatccaaatgttcaaact
attttagctactggtggtcctggaatggttaaggcagcttattcatctggtaaacctgca
atcggtgttggtccaggtaatggtccttcatatattgaaaagaccgccaatattccagaa
tccgtctatgatattgtcctctctaaaacttttgataatggtatgatttgttcctccgaa
aattctgtagtagttgatgaggatatctataacgaagtaaaagatgaatttaagtcttgg
aattgttatttcttaaaaccagatgaaattaagaagttcgaagaaaaattcattgatcct
aagagaggaactgttgctggtccagttgctggtcgttcggcttatcaaattgcaaaatta
tgtggagtagatgtaccagaagatactaaggtaattattgccgaatacaagggtgtgggt
aaaaagtatcctttatctgctgaaaagctttctcctgtatttaccatgtataaagctaag
ggtcatgaagatgcctataagatttgtaccgaccttctaaattatggtgggcgcggccat
actgcgggggttcattctcaagatgaaaaagtaattgatgagttttcaatgaaaatggat
gcatgccgtattttggttaactctccagcttcagttggtggcgttggtgacttgtacaac
aatatgcttccttcccttactttagggaccggttcatatggtgctaatactttttcacat
aatattggtgctagagacttgcttaacattaagacagttgcaaaacgtcgtgataatatg
caatggatcaaggttccaaagaagacatattttgaacataatgcagcaaattatttaaag
catatgcctgatgttgaaagatttttcatcgtgactgatgaaggtgtagccagcaaatac
attaatgaaattactgatattattagtcaacgtcgtggtaaaaagagctatgaggtcttt
caagcagtaactaaggacccagatactgatataattgctgatggtgttcaccggatgaat
atctttaagccggatgtcgtgattgctattggtggtggatctgtaatggatgctgctaag
gcaatgcgattattctacgaaaatccagatatgagttttgaagatgcttactcaaaattt
ttagatatcagaaaaagaacagtaagatttccaaaatataatgctatccaattagtatgt
attccaactacttcaggaactggttcagaagtatcaccattttcaattatcaaggatgct
aaaacaggaattaaacatactctctgtgattattctttaaatcctgatgttgccatcgtt
gacgatcaatttgtagaaactatgccaaaggaattgattgctcgctctggttttgaagca
ttagctcatgcagtagaaagttatgtttcgactatggccactgattttactcgtggctgg
tcgatggaagctatcaagttgatttttgaaaacttagaaaaatcatataatggtgatcaa
aatgctagaagtagaatgcataatgcagctactttagctggcatggcatatgcgaatgca
ttcttaggtgtaggacatgcaattgctcatacagaatcatctgagtttggtattccaagt
ggcttaagtgatgctattgcaatgccatatgtgattagattcaattctaaaaagcctaga
aaacttgctatgcgtccacattattcaacttttagagctgataaagattatgcagaaatt
gcacgtagtctgggactaaaaggaaatagcgaccaagaactaattgatgctttaatcaag
aaagttgttgaattaggacatgctgttgggatgaagttaagccttaaagctaatggaatt
agtgaagctgattttaataataaggtagaaaacatggccgttgaagcttatggcgaccaa
aacgttgtaacaaatccttctgctttattaattagtgaaattaagaatctaatgaaagaa
acctacactggaaagggtattgaagcttaa

DBGET integrated database retrieval system