KEGG   Lactobacillus kefiranofaciens: WANG_0114Help
Entry
WANG_0114         CDS       T01526                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lke00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WANG_0114 (ruvA)
Enzymes [BR:lke01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     WANG_0114 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97391..97978
Genome map
AA seq 195 aa AA seqDB search
MYEYFDGIITVVAPSYVVVDVGGVGYKVYSPTPFAYTQGQKAKVFIEQVVRDTGITLYGF
QSQDDKGLFLKLLSVSGIGPKSALAIMAAEDSDSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVARLDRTDDGEDVPPALNDALLALIALGYTQKEVDRITPKLEKFDADT
ADQYIKKGLALLLKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatattttgatggcataattactgtagttgcgccaagttatgtcgtggttgat
gtaggtggtgttggctataaagtttacagcccgacgccatttgcttatacgcaaggacaa
aaggccaaggtttttattgagcaagttgtacgtgatactggaattacgctatatggtttt
caaagccaagatgataaaggcttgtttcttaaattgcttagtgtcagcggcattggacct
aaaagcgcgttggcgattatggcagcggaagacagtgattcgttagctgaggcaattgaa
caaggtgaagtaaagtacttaacccgttttcctggcgtgggcaaaaaaacagcttctcag
attgtactcgatctcaaaggcaagctaggcgattatgttgcgcggctggatagaacagat
gatggcgaagatgtgccaccagccttaaatgatgcgttattagccctaattgcgctaggt
tatacccaaaaagaggtcgaccggattacgccaaaattagaaaaatttgatgcagatacg
gctgatcaatatattaaaaaaggcttggcattactgcttaaaaagtag

DBGET integrated database retrieval system