KEGG   Lactobacillus kefiranofaciens: WANG_0188Help
Entry
WANG_0188         CDS       T01526                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lke00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lke00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lke00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201091..203313
Genome map
AA seq 740 aa AA seqDB search
MIDIISKQYFHLHNEKISYLFYVMKNGQLGHLYYGKDLGDLTEDDLRYIACHNNKASGTV
KFAPEFSTFSLADRMQEYPTYGTSDFREGAISLEQGKDILYPDFKYQDYSVSNQRPRNLA
KPGAYSEAGESQTLTIRLLDQDHQLELKLFYTIFKHNSAIVRNSQIRNIGNDDIKIQNLQ
SLTLELPTSDYDFLQLSGAWIKERHIKKRPLIQGITKIESLRGASSHQENPFIALTAKNV
SLNHGEIYASNLIYSGNFVSQVEVDEWGTGRLMTGINPATFTWQLKKDEVFASPEAVIFY
TNHGYNGLMTQTHQFAKQHIIDRKWQTIKRPIVINSWEACVFDFDEAKLLKLAQEAKNLG
MECFVLDDGWFGHRDNDRTSLGDWSVDRKKFPQGLDHFSSALHKMGMQFGLWFEPGMVSP
NTALFKRHPDWVVHHPYSRYSIGRGQYVLDFANPEVVDDIYQQMARIISKCHVDYLKWDM
NRNITEAYSPYLKKLHLPQGEFFHRYILGVYHLYEKLLTSFPHLLIEGCASGGGRYDLGI
MFYSPQIWPSDDSDAAERLDIMSGTMLAYPLSAFSNHVSAVPNGHVRRITSLKFRQDVAS
FGPLGYELDLNALSFPQKQAIHDQIEWYKQRRDLLVNGSFRQLIPLDDHNKYAWSVSKSK
EQIIGFFRKLAKPNDTLDQYLSLSDLNLKAHYTINQQMTVSGKMLASFGLREPYQFNASN
ANTAQVAGDFQSYLFELKQD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatataatctctaagcaatatttccatttacataatgaaaaaataagttatttg
ttttatgtgatgaaaaatggacagctgggacacttatactatggtaaagatttaggtgac
ttaactgaagatgatttgcgttatatagcatgtcataataacaaagcatccggcacggtt
aagtttgcgccagaattttctaccttttctctggctgaccgaatgcaggaatatcctact
tatggaacttcggattttcgtgaaggtgcaattagcttagaacaaggcaaagatatatta
tatcctgactttaagtatcaagattatagtgtcagtaatcaaaggccccgaaatttagct
aaacctggtgcatattctgaagcaggagaatcacagactttgactattcgattgctggat
caagatcatcaattggaattaaaattattttatactatttttaaacataacagcgcaatt
gttcgtaatagtcagatcaggaatattggcaatgatgatattaagattcaaaacttgcaa
agcctaaccttggagctgcctacttctgattatgattttttgcagttgtcgggtgcatgg
attaaggagcgtcacatcaaaaaaagacccttaattcaagggattactaaaattgaatcc
ttgcgtggtgcgtctagtcatcaagaaaatccatttatcgcgttaaccgcaaaaaatgtg
tcgcttaatcatggtgaaatttatgccagtaatttaatttattctgggaactttgttagt
caagtagaggtagacgagtggggaactggtcgcttgatgactggtattaatcctgctacc
tttacttggcaattgaagaaagatgaagtttttgctagtcctgaagcagttattttctat
actaatcatggttataacggcttgatgacgcaaacacatcaatttgcaaaacagcatatt
attgatcgaaaatggcagactattaagcgaccaattgtgattaatagttgggaagcatgt
gtttttgattttgatgaagctaaattattgaagttagcccaagaagctaagaatctagga
atggaatgttttgtcctagatgatggttggtttggacatcgtgataacgatcggacatca
ttaggtgattggtctgttgatcgcaagaagttcccacaaggactagatcattttagcagt
gctttgcataagatggggatgcaatttggattatggtttgaaccgggaatggtttcccct
aatacagccttgttcaagcgacatcctgattgggtcgtgcatcatccttattcacgttat
agtattgggcgaggccaatatgtgttagattttgctaaccctgaagttgttgatgatatt
tatcaacaaatggcaagaataattagtaaatgtcatgttgactatcttaagtgggatatg
aatcgtaatattacggaagcatattctccttatttgaaaaagctgcatttgccacaagga
gagtttttccatcgctatattttaggtgtttatcatttatacgaaaagttattaactagt
tttcctcatctattaattgaaggttgcgctagtggtggtggacgttatgacttaggtatt
atgttttatagtccgcaaatttggcctagcgatgatagcgatgcggctgaacgacttgat
atcatgtctggtacaatgctggcatatcctttatcagcttttagtaatcatgtttctgca
gttcctaatggacatgttagaagaataactagtttgaaatttagacaggatgtagcttca
tttggtccgctgggttatgaattagacttaaacgcactttctttccctcaaaaacaagca
atccatgaccaaattgaatggtataagcaaagacgtgatttacttgttaatgggtcattt
agacaactgatacctttagatgatcacaataaatatgcgtggagcgtaagcaaaagcaaa
gaacaaataataggatttttccgcaaattagctaaaccgaatgatacgcttgatcaatat
ctttccctctctgatttgaaccttaaagcacattatacgattaatcaacaaatgactgtt
agcggaaaaatgttagctagtttcggcttacgtgaaccatatcagtttaatgcttctaat
gcaaatacggctcaagtagcaggtgattttcagtcatacttattcgaactaaaacaagat
tag

DBGET integrated database retrieval system