KEGG   Lactobacillus kefiranofaciens: WANG_0188Help
Entry
WANG_0188         CDS       T01526                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
lke00052  Galactose metabolism
lke00561  Glycerolipid metabolism
lke00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    WANG_0188
  Lipid metabolism
   00561 Glycerolipid metabolism
    WANG_0188
   00600 Sphingolipid metabolism
    WANG_0188
Enzymes [BR:lke01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     WANG_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_31 Glyco_hydro_36C Melibiase_2
Motif
Other DBs
NCBI-ProteinID: AEG39883
Position
201091..203313
Genome map
AA seq 740 aa AA seqDB search
MIDIISKQYFHLHNEKISYLFYVMKNGQLGHLYYGKDLGDLTEDDLRYIACHNNKASGTV
KFAPEFSTFSLADRMQEYPTYGTSDFREGAISLEQGKDILYPDFKYQDYSVSNQRPRNLA
KPGAYSEAGESQTLTIRLLDQDHQLELKLFYTIFKHNSAIVRNSQIRNIGNDDIKIQNLQ
SLTLELPTSDYDFLQLSGAWIKERHIKKRPLIQGITKIESLRGASSHQENPFIALTAKNV
SLNHGEIYASNLIYSGNFVSQVEVDEWGTGRLMTGINPATFTWQLKKDEVFASPEAVIFY
TNHGYNGLMTQTHQFAKQHIIDRKWQTIKRPIVINSWEACVFDFDEAKLLKLAQEAKNLG
MECFVLDDGWFGHRDNDRTSLGDWSVDRKKFPQGLDHFSSALHKMGMQFGLWFEPGMVSP
NTALFKRHPDWVVHHPYSRYSIGRGQYVLDFANPEVVDDIYQQMARIISKCHVDYLKWDM
NRNITEAYSPYLKKLHLPQGEFFHRYILGVYHLYEKLLTSFPHLLIEGCASGGGRYDLGI
MFYSPQIWPSDDSDAAERLDIMSGTMLAYPLSAFSNHVSAVPNGHVRRITSLKFRQDVAS
FGPLGYELDLNALSFPQKQAIHDQIEWYKQRRDLLVNGSFRQLIPLDDHNKYAWSVSKSK
EQIIGFFRKLAKPNDTLDQYLSLSDLNLKAHYTINQQMTVSGKMLASFGLREPYQFNASN
ANTAQVAGDFQSYLFELKQD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatataatctctaagcaatatttccatttacataatgaaaaaataagttatttg
ttttatgtgatgaaaaatggacagctgggacacttatactatggtaaagatttaggtgac
ttaactgaagatgatttgcgttatatagcatgtcataataacaaagcatccggcacggtt
aagtttgcgccagaattttctaccttttctctggctgaccgaatgcaggaatatcctact
tatggaacttcggattttcgtgaaggtgcaattagcttagaacaaggcaaagatatatta
tatcctgactttaagtatcaagattatagtgtcagtaatcaaaggccccgaaatttagct
aaacctggtgcatattctgaagcaggagaatcacagactttgactattcgattgctggat
caagatcatcaattggaattaaaattattttatactatttttaaacataacagcgcaatt
gttcgtaatagtcagatcaggaatattggcaatgatgatattaagattcaaaacttgcaa
agcctaaccttggagctgcctacttctgattatgattttttgcagttgtcgggtgcatgg
attaaggagcgtcacatcaaaaaaagacccttaattcaagggattactaaaattgaatcc
ttgcgtggtgcgtctagtcatcaagaaaatccatttatcgcgttaaccgcaaaaaatgtg
tcgcttaatcatggtgaaatttatgccagtaatttaatttattctgggaactttgttagt
caagtagaggtagacgagtggggaactggtcgcttgatgactggtattaatcctgctacc
tttacttggcaattgaagaaagatgaagtttttgctagtcctgaagcagttattttctat
actaatcatggttataacggcttgatgacgcaaacacatcaatttgcaaaacagcatatt
attgatcgaaaatggcagactattaagcgaccaattgtgattaatagttgggaagcatgt
gtttttgattttgatgaagctaaattattgaagttagcccaagaagctaagaatctagga
atggaatgttttgtcctagatgatggttggtttggacatcgtgataacgatcggacatca
ttaggtgattggtctgttgatcgcaagaagttcccacaaggactagatcattttagcagt
gctttgcataagatggggatgcaatttggattatggtttgaaccgggaatggtttcccct
aatacagccttgttcaagcgacatcctgattgggtcgtgcatcatccttattcacgttat
agtattgggcgaggccaatatgtgttagattttgctaaccctgaagttgttgatgatatt
tatcaacaaatggcaagaataattagtaaatgtcatgttgactatcttaagtgggatatg
aatcgtaatattacggaagcatattctccttatttgaaaaagctgcatttgccacaagga
gagtttttccatcgctatattttaggtgtttatcatttatacgaaaagttattaactagt
tttcctcatctattaattgaaggttgcgctagtggtggtggacgttatgacttaggtatt
atgttttatagtccgcaaatttggcctagcgatgatagcgatgcggctgaacgacttgat
atcatgtctggtacaatgctggcatatcctttatcagcttttagtaatcatgtttctgca
gttcctaatggacatgttagaagaataactagtttgaaatttagacaggatgtagcttca
tttggtccgctgggttatgaattagacttaaacgcactttctttccctcaaaaacaagca
atccatgaccaaattgaatggtataagcaaagacgtgatttacttgttaatgggtcattt
agacaactgatacctttagatgatcacaataaatatgcgtggagcgtaagcaaaagcaaa
gaacaaataataggatttttccgcaaattagctaaaccgaatgatacgcttgatcaatat
ctttccctctctgatttgaaccttaaagcacattatacgattaatcaacaaatgactgtt
agcggaaaaatgttagctagtttcggcttacgtgaaccatatcagtttaatgcttctaat
gcaaatacggctcaagtagcaggtgattttcagtcatacttattcgaactaaaacaagat
tag

DBGET integrated database retrieval system