KEGG   Lactobacillus kefiranofaciens: WANG_0241Help
Entry
WANG_0241         CDS       T01526                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lke00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    WANG_0241
Enzymes [BR:lke01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     WANG_0241
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     WANG_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253027..253857
Genome map
AA seq 276 aa AA seqDB search
MPEMPEVETVRRTLIPLVKGKTIEKVILWYPKIVATDHEHFLTELPGKEIIDIDRYAKYL
LIRLSDNLTIVSHLRMEGKYHLTTPNAPKDKHDHVEFIFTDGTALRYNDVRKFGRMQLIL
TGTEKQATAIGKLGPEPNSPEFSDQYFIASLKRKKKNIKNTLLDQKTVAGLGNIYVDETL
WQSGIHPLSSANKIPADKVKELRRNINETITIATKERGTTVHTYLDANGQTGGYQKMLKV
YGHAGEACSKCGTTLEKIKVSGRGTTFCPKCQVMYQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaatgcctgaagtagaaaccgtacggcgaactttaattcctttagtcaaagga
aaaacaattgaaaaagtaattctgtggtatcccaagattgtggcgacggatcatgaacat
tttttaacggagcttcctggtaaagaaattattgatattgaccgctatgccaagtatttg
cttattcgtttgagcgataatttaacgatcgtttcgcatttacgcatggaaggcaaatat
catttgaccacgccaaatgcgcctaaggataagcatgatcatgtggaatttatttttact
gatggtacggctttgcgctataacgacgtgcgaaagttcggccgcatgcagctgatttta
actggtactgaaaaacaagcgacggcaatcggcaaactgggccccgagcctaatagtccg
gaatttagcgaccaatattttattgctagtttaaagcgcaagaagaaaaacatcaaaaat
actttgcttgatcaaaagaccgttgcgggcctgggcaatatctatgttgatgaaaccttg
tggcaaagcgggatccatcccttaagcagcgccaataagatcccggctgataaagtgaag
gagttgcgtcgcaacattaacgaaacaattaccattgctactaaagaacgcggcacaacg
gtgcatacttatctggatgccaatggtcaaaccggcggctatcaaaaaatgcttaaggtt
tacggtcatgctggcgaagcttgttctaagtgcggcacgacgctagaaaaaattaaggtt
tcaggcagaggtactactttttgccccaagtgtcaggtgatgtatcaatga

DBGET integrated database retrieval system